CAZyme Information: mRNA_M_BR32_EuGene_00008961-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00008961-p1
• CAZy Family: AA13|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	BR32_scaffold00001|CGC17	24100.98	6.7377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:2646854-2648037(-)

Full Sequence      

MKITTSAVLACLTAAVSAQVQGTGATTRYWDCCKPSCGWPGKANLASGPLRTCDKADNPL
NDGGNTKSGCDNGGGAFMCSSQEPLAVDDSLAYGFAAVRISGQRESDWCCACYELTFTSG
SVAGQRMIDLLRNTGGDLGQNHFDIAMPGGGVGIFNACTEQYGAPANGWGERYGGVRSRS
ECDAFPEKLKKGCYWRFDWFKGADNPSVSFKQVTCPSELTSKSGCVRA

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	24	225	6.1e-90	0.98989898989899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.34e-77	23	225	1	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56098.1|GH45	2.08e-169	1	228	1	228
UQC88154.1|GH45	5.20e-128	16	227	19	233
AGY80100.1|GH45	2.67e-122	21	227	4	209
AEO65930.1|GH45	7.04e-120	1	227	1	227
ACK18416.1|GH45	1.69e-119	1	227	1	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4U_A	5.04e-91	8	227	6	221	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
6MVI_A	5.51e-90	9	227	12	223	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	1.05e-88	21	227	2	202	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.21e-88	21	227	5	205	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1HD5_A	4.27e-88	24	227	3	201	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D3GDK4|GUN_CRYAT	2.12e-90	8	227	6	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P45699|GUNK_FUSOX	2.68e-88	15	227	14	221	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	1.79e-86	24	227	3	201	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|O97401|GUN_PHACE	9.19e-53	16	225	32	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	1.22e-44	24	228	269	501	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999756	CS pos: 18-19. Pr: 0.9642

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00008961-p1.