CAZyme Information: mRNA_M_BR32_EuGene_00008141-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00008141-p1
• CAZy Family: AA12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698		78512.01	4.7103

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:2402978-2405315(-)

Full Sequence      

MSPLWKTAAAIAVAASGSLVNAVYINGSIITPCDSLIYCRGELLKEVELAHPFADSKTFV
DMPTIKPVDEVIEAFNKLQKPLSNNTELQDFLRENFAQAGGELEEVPNSELETDPVFLDK
LDDTVIREFVEKVIDIWPSLTRRYKGPSNCEACADSFIPVNRTFVVAGGRFREPYYWDSY
WILEGLLRTGGAFTNISKNTVENFLDLVETIGFVPNGARIYYKNRSQPPLLSQMVRIYVE
HTNDTSILGRAVPLLIKEHEFFINNRSIDVEASNGKTYRLQRYAVTNTQPRPESYREDYI
TASNRSYYSPSGIIYPESHQLNESEKAVLYSHLASGAESGWDYTSRWLSTPSDAVRDNYF
PLRSLNTNNIVPVDLNSILYANEVAIAEFLNRTGNSTGASDWMDLAKQRSEAMYALMWNE
TLWSYFDYNMTSKTQNRFIPVDEDAVSIETNNAPAGQQVFFHVAQYYPFWTGAAPRSLKN
NPLAVLRAYERIDAYLDIKRGAIPATNLKTGQQWDEPNVWPPLMHILMEGLTRVPATFGE
DDVAWTEIQDLALRLGQRYLDSTFCTWYATGGSTSETPQLQGLNAEDKGIMFEKYGDNST
NVAGSGGEYEVVEGFGWTNGVLMWVADTFNNKLTRPDCGNITAANVHSDGSQARKRGEMW
SALEMHPYDAAWTKEFGARKVRRDKAEARALGNVMGGV

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	53	627	2.9e-161	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	6.46e-137	53	621	3	500	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	8.12e-126	36	623	11	538	alpha,alpha-trehalase
224541	TreA	7.60e-83	37	635	55	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	2.54e-80	42	629	51	536	alpha,alpha-trehalase TreA.
237326	treA	1.07e-73	41	627	49	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN38003.1|GH37	0.0	1	698	1	698
QBZ56021.1|GH37	0.0	1	698	1	698
AEO53147.1|GH37	0.0	6	687	4	686
UQC80667.1|GH37	0.0	12	691	1009	1687
AEO70020.1|GH37	0.0	9	684	8	686

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.40e-69	55	623	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	3.33e-68	55	623	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	3.85e-65	32	643	9	514	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	1.86e-63	41	627	52	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	9.80e-62	32	643	9	514	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	5.95e-114	33	638	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|O43280|TREA_HUMAN	3.08e-110	32	634	27	555	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	1.47e-109	32	634	27	554	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	1.95e-109	32	634	24	552	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	8.22e-107	14	651	24	585	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003549	0.996418	CS pos: 22-23. Pr: 0.8976

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00008141-p1.