CAZyme Information: mRNA_M_BR32_EuGene_00006211-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00006211-p1
• CAZy Family: AA11
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795		85049.35	8.1367

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:1809424-1812705(+)

Full Sequence      

MSKPDLVYNDAALEAPPPPYELHSTGDVLSVSAAVTATGSIDVAFTSTAQADLRQLIDSQ
QNRGQQNEPHPSAQSNDLGSIPSGNVPSLNIVIQVVGSRGDVQPFIALGVALKRRGHRVR
LATHDTFDKFVRESGIEFYPIGGDPADLMAYMVKNPGLMPSLESLRGGDIGRKRSMVKEM
LHGCWLSCVDADPASGAPFVADAIIANPPSFAHVHCAQALSIPVHIIFTMPWCATRAFPH
PLANIKQKGIEPANANWLTYGVVDLMTWQGLGDVINGWRKQDLELEPLNASMGPGINSYL
RIPHTYCWSPSLVSKPADWGPEIDVCGFFMRDPPAYQPPPDLEAFLSAGPPPVYVGFGSI
VLEDPARLTDVILEATRRCGVRVIISRGWSKLGGDSPSNQHVFYLGDCPHEWLFTKVSAV
VHHGGAGTTACGLSNGRPTIIVPFFGDQPFWANVVAAAGAGPRPIPQMEMTVERLTEALQ
FALSPDATRAAAILAQKMGQEDGVATAVESFHRWLPLEKMRCEIDPSRVARWEVEVKGKR
RLRLSDTVVTTLLAEKQIKKDDLHALKSKEYNTDVQRWDPLSGGASSTLGMVTDFTTALG
GTFIDPFRAYKLKRKDGSSGSAGGAAMMSAAGGVGSMVGVVTKGTLVDTPLALAEGLRNI
PKLYGEEVKNHGQVKGVGSGSVVAAKNFGHGFYDGLTGFVTQPYKGAKEEGALGFLKGAG
KGTAGLIVKPGSAMLGLMAYPAQGVYKSIRAARGRKAAVKKSKSDLLDWKAPVSDVQIDT
RQVCIDFGALSRASK

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	108	513	1.6e-59	0.9842931937172775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.63e-78	89	514	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.08e-42	91	513	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.82e-26	91	239	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.26e-06	100	491	7	365	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	2.38e-05	679	749	2339	2413	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55835.1|GT1	0.0	1	795	7	801
QPC76318.1|GT1	0.0	10	750	23	758
QPC67427.1|GT1	0.0	10	750	9	744
CZS77295.1|GT1	0.0	10	750	22	757
CEF74027.1|GT1	0.0	10	750	22	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	5.13e-76	96	515	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	8.67e-76	96	515	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	9.33e-34	89	507	1	390	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	2.10e-31	89	509	1	393	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
3H4I_A	1.89e-30	89	509	1	375	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	2.56e-137	86	526	190	620	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	4.45e-135	85	518	152	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q0CKU4|ATG26_ASPTN	7.44e-78	68	519	877	1319	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
sp|A1CFB3|ATG26_ASPCL	3.48e-77	46	513	856	1323	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	5.55e-76	78	516	1153	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00006211-p1.