CAZyme Information: mRNA_M_BR32_EuGene_00005371-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00005371-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	BR32_scaffold00001|CGC12	85321.21	7.5858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:1573289-1575807(-)

Full Sequence      

MAGKLEQKDSATKTDKMEKNSAIAPARPQVIELGEMQAGDFWTPVQWAVLVSLVDAILAP
VVPESEVADKKTQIKIPDHKYNALLEELHSTIAGNPDKEVLKAVFLESFSTNPALVGHMK
RTVCTSVHPKLRARLGGVLAAVSTRVGAFFLTGYCTPVHEQPLHIREAIVRGWSVSRLTD
IRLLVKSLSMFAQIAWLQCSPLFKQASGYIDVPHNWKPGPSFDFEFLQFGRPPNVEDNLA
PVSPAVIDTDIVIVGSGCGGGVCAKILSEAGHKVVVVDKGYYFTPDQFPMPQEQGSRLLC
ENGGVVVTADGSTNIAAGSTWGGGGTINWSVCLQTQGFVRREWSQDRGLVFFETEEFQDC
LDRVCDYMGAGRGSEHAVKQTHRGQVLLDGCRKLGWHAAALPQNSGGAEHWCGRCMMGCG
SAEKQSPAVSWLPAAKKAGATFIEGFQVDKITFDEASGGKVATGVVGTWTSRDSSGGVTG
PKEQRAVRKVSIKAKKVIVSAGSLWSPVILSKSGVKNRHLGHNLYLHPCNFIGAYYKEDI
QAWDGGIITSFCTSFEDLDGHGHGVKLEPTCQIPYTNMSMLPWKSSTDFKAAAIKYRHMD
VYIALTRDRDSGRIQVDPTTGTPVVHYTPSDFDRAHTLEGVIATAKCCYLMGATEIRAFL
PGVEPFIRRPTSASSTTSADTNDDVKKSNLGVSDPDFAAWIKEVRRVGNRPPVAPFSSAH
QMGTCRMGINEGEGVVDPKGHVWGYKNLFVADASVFPSASGVNPMITNMAISDYIARGVD
RELASKSA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00005371-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	248	777	9.4e-122	0.9598540145985401

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	6.59e-53	299	529	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	8.87e-33	264	772	23	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.37e-27	608	771	1	139	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	8.46e-09	249	767	1	474	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
274143	pyranose_ox	2.13e-07	666	770	438	533	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	5.00e-203	46	784	29	735
ADT70776.1|AA3_1|AA8|1.1.99.18	2.92e-10	231	774	224	775
EGX44283.1|AA3_1|AA8|CBM1	1.06e-08	250	776	252	780
UJO12159.1|AA3_3	1.49e-08	238	787	5	593
QRD04249.1|AA3_3	5.97e-08	246	788	11	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	4.20e-09	244	787	225	771	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
7DVE_A	4.69e-07	709	788	432	513	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
4QI4_A	2.60e-06	244	764	3	527	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	2.98e-06	244	764	225	749	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	6.39e-90	247	787	237	750	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	3.34e-85	138	767	95	728	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	1.14e-80	86	785	39	742	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q9ZWB9|FAO1_ARATH	3.23e-74	247	767	244	736	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2
sp|Q94BP3|FAO4B_ARATH	5.14e-74	110	787	62	746	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00005371-p1.