CAZyme Information: mRNA_M_BR32_EuGene_00004531-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00004531-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	BR32_scaffold00001|CGC22	43515.09	4.8050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00001:1334062-1335273(+)

Full Sequence      

MNLRTVTGSASSILLILSSIHVAVADLPLVSDSKCGCYVTNGSNSAFFTSHRFYDFRSLS
QYVGSGIPDAPSSSPQAASNASITSGYFNTSAFTDDWSIMTWNNSASVGGDAAILMVNSP
TNLFIQKNNDTDADSDTYLTMRTARNEDFQSASEIESNSNRYRFVSMRMLARTTGAPGAC
TALFTYRSAKDYADVQEADIEVLTKDPTDKIMYTNQPSYVKVGNDTQNIPESNINGTAPV
DWTQWSVHRLDWTPLRTTWYVDGRQVASISFQTPRDASRINLNSWSDGGDWTGLMDVGKE
ARMQIKWLEMVFNQTSSGTSRMRPRDHTGNSGRGSGNGNSGGASDSGSTEGLSDGKCRTV
CSIDDTDQRGMAAVVADGGAATLKLAAWIPISVALVTMAASMF

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00004531-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	310	1.2e-93	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	7.46e-58	89	311	5	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	8.60e-09	126	308	30	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.82e-05	150	292	20	156	Glycosyl hydrolases family 16.
225182	BglS	1.19e-04	144	307	98	259	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	0.004	223	307	138	231	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55690.1|GH16_22	6.39e-277	1	403	1	403
CEF84700.1|GH16_22	5.16e-109	23	385	17	368
AAT84251.1|GH16_22	5.16e-109	23	385	17	368
CZS72348.1|GH16_22	7.30e-109	23	385	17	368
QPC74272.1|GH16_22	1.01e-106	23	380	17	363

PDB Hits     

mRNA_M_BR32_EuGene_00004531-p1 has no PDB hit.

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00004531-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999657	CS pos: 25-26. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00004531-p1.