CAZyme Information: jhhlp_008816-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008816-t41_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724		81994.54	7.6201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:2258416-2260590(-)

Full Sequence      

MSSSIGHHYPSGPRRFDSPLSSPRTLTPGSPTNPFSPGNPEMGQLPQPSPVFLRSEGEPG
RPRSRDSPIVEPWSPYAGPSSASASPMLGPAYPHSRASSVTLGGTDTVPPSPKGSSFQLA
EEDPFTGIIDSDDEAGKHEKEKKKRRCMGPADICRALWAGFRRQISFHAIFEAIDIRDIF
WPFSWRKYFVLLGVCACVAGIVVSNHYFHWIEKAMAQTRTFMLPVLVIVIGLEPLMILFI
LCVAKIPDAKDIISPRYPHALEEIRAQQKAQQRGMRVAEVETDDFVKMKQRNLTKPSEKT
DLEATFISEPISTRPNDTALVLPCHNSDREALKRVLESAYPHFRPQDIFIVDNGRSKRPN
DPTFRDWVKEQHPDLVYIWSPIGSKNAAQLVGSIAARHHKYILTVDDDVCIPANYESPEE
MITDEIKAVALPLMGMDPEGNTSLFLVAWQDCEYRMAGVTKMAEDRICGVTFPHGAGWFV
ERDAYITMLSEYHPMDFIAEDVNSGLSFMRMGKQITMDGRIVLKTEVPTTILGPGLNWWK
QRYKSWEMGRHGLTLKFMIRTLFSLNGQRTIHGILFQKFLFIYNLLSNVIDFVRIPIFVT
MGNTGMFWLQACLLSLFSIIPILAYNYIKCRRRPDMRCRFWGAITFPIYKQLYSLVSIFG
AVRCVLFYIGGHKMPPTVQEMIKNNDDRCIWLDPRFEENPGFLGDPDQPDVNLSTSRLDI
DKST

Enzyme Prediction     

No EC number prediction in jhhlp_008816-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185628	PTZ00449	1.99e-07	10	93	585	666	104 kDa microneme/rhoptry antigen; Provisional
224136	BcsA	8.16e-07	310	669	48	393	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.02e-05	320	501	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
395426	Glycos_transf_2	2.84e-05	321	485	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
132997	Glyco_tranf_GTA_type	5.82e-05	321	415	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66493.1|GT2	5.28e-203	158	705	123	635
QGI62687.1|GT2	7.48e-203	158	705	123	635
QGI93580.1|GT2	7.48e-203	158	705	123	635
QGI79854.1|GT2	8.51e-202	158	705	123	635
QKD50674.1|GT2	3.75e-199	63	705	51	644

PDB Hits     

jhhlp_008816-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

jhhlp_008816-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

Start	End
189	211
221	243
579	601
606	628
640	662