CAZyme Information: jhhlp_008811-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008811-t41_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		70806.54	4.5098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:2238044-2240249(+)

Full Sequence      

MTLSAALLVSFAASTAALSHVAVKRQISELDDIYDFVIAGGGTAGLTVADRLTEAFPEKT
VLVIEYGEIEYAPGTFDPPLLVWGGAGAAASRWTFDSLPNPEVLNQKALVFAGQVVGGSS
AVNGMFFDRPSRWDFEAWNQLLSPEYDDCSEKWDWDGIFPFFKKAVTFTEPTAEMVADHG
YTWDLDVYPGTTPIYSSYPPFLWGDHNVARDTWIDMGIPVLEECAGGDKTGLCWIPISEH
PVTARRSHSGLGHYAAVNETRSNYHFLVKHQVTRVLYPEGLESGPPVVEVRNRNDDSLFN
VTAEAEVILSAGSFHTPTILQRSGIGPASFLSEADIPLVLDLPGVGSNFHDHWGPAFSWN
YTSPGDWSPMPSDMQDPDFAADATAGFDETPARGPYTLAMSNSALFLSLSNVTDDYLDIV
DKIRDMVDDDSAASYLPEEYRSNPEMVAGYKHQLSVLADFYENPQAPSLETAFATGTSMR
SIMLHGLSRGTVRLNLTHPLEKPIVDYRAGSNPVDFDIHLAHLKYLLGMFDTQTMQDFGA
YLLTPDSSVVTDEDLLQYAKETMVFSFMHPCCTSTMMPKAKGGVVGPDLKVHGASGLRIA
DISVLPFTPSSHTSQEAYAIGEKVRADRRLLILSPNMPRHSHFRT

Enzyme Prediction     

No EC number prediction in jhhlp_008811-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	624	6.2e-137	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.17e-54	34	628	8	532	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.51e-47	34	628	6	530	choline dehydrogenase; Validated
274888	Rv0697	2.03e-31	35	624	2	482	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.04e-24	488	623	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.42e-18	85	352	7	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84441.1|AA3_2	7.29e-252	3	623	9	624
AEO67447.1|AA3_2	8.81e-243	1	623	1	631
CDP31201.1|AA3_2	9.61e-242	20	623	25	624
QRD01783.1|AA3_2	3.85e-230	125	623	1	498
UQC77231.1|AA3_2	3.60e-116	24	623	34	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	2.58e-261	5	623	5	633	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	4.20e-97	34	624	6	578	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	1.58e-50	34	626	41	595	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6XUT_A	4.73e-44	34	623	17	582	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	2.93e-43	34	628	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.56e-88	34	623	38	608	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	2.85e-54	34	627	47	613	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.85e-54	34	627	47	613	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q0R4L2|PDH3_LEUMG	3.54e-52	34	622	41	589	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L245|PDH1_LEUMG	8.15e-50	34	626	41	595	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.187195	0.812778	CS pos: 17-18. Pr: 0.7754

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008811-t41_1-p1.