CAZyme Information: jhhlp_008798-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008798-t41_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	NLAX01001623|CGC12	41706.64	4.1210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:2187917-2189095(-)

Full Sequence      

MRFSTTLSAAALVASALAADNYLGFNSGSTKADRSAKFKKDWVAEFTTAQNLKNAPGTFN
AVRLYTNIQAYSEDDPIEAFEAAIETDTYILLGIWTSGTDSIDKELSALKKAVEKYGDKL
TKLIIGISIGSEDLYRNSVTGVTNKAGIGADPDVIVGFINDYRTAFKNTDLASVPVGHVD
TWDVWGNSTNKPVLDAIDFIGVDEYPYYETGKGNNIKNSGQLFDRAFKATLDAAGGKPVW
VTETGWPASGPSWDEAESSVENAKYYWDEIGCRVLFNKYPTFWYNLRDSNPDNEMQFAIT
KDLSTTPLFDLTCPTTFQTPEASTDGTNSTDGSGSGSGSGSGSGSGSGTNSGSSSEDDSE
EGGAGDASSASGYTFSIASVALGVVGAFFTLF

Enzyme Prediction     

No EC number prediction in jhhlp_008798-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	66	292	6.4e-16	0.8263665594855305

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.64e-25	23	272	46	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.29e-09	82	290	60	283	Glycosyl hydrolases family 17.
381626	GH113_mannanase-like	0.004	185	259	168	248	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57324.1|GH17	9.65e-179	1	323	1	323
ATY67306.1|GH17	4.39e-177	4	319	5	320
UQC77015.1|GH17	3.85e-176	1	323	1	323
CAQ16224.1|GH17	5.04e-176	1	315	1	315
CDP32718.1|GH17	1.73e-174	1	330	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.04e-16	48	274	51	254	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	6.46e-95	22	313	20	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|A1DJ47|EGLC_NEOFI	2.71e-94	1	324	1	321	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	2.71e-93	1	313	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.04e-93	1	313	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	8.55e-93	1	330	1	328	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000373	0.999611	CS pos: 18-19. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008798-t41_1-p1.