CAZyme Information: jhhlp_008371-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008371-t41_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664		71976.92	4.1414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:563774-565952(+)

Full Sequence      

MGRSLFRSVAIVLALAAPFGNAAPRGLNKARVLKEPSELEDSYDYVIVGAGTAGLTIADR
LTEDDDVTVLVVEYGPLSESPKIATIQGGFSGMDSAFMFPTQSVPQVNLGNRRTAVLAGK
VVGGSSAVNALMTIRGAKGDYNRWGSFFGDESEWSWDGLLPYFKKALTFVPPNEDVAAES
DIIYDTSYWGNTSDVYTSWPSFQYPGTAAQVEAWKVMEGVQFTPDSGSGETGVFWYPQFM
DPTIAERSYARTGHYSNRDRANYHLVTNSKVIRVDLEDGTATGVSFRPGDDPEGEVTSIS
AKKEVILSAGAVHTPQIMQLSGLGPSDVLEEAGIETKVNLPGVGKNFQDHPMLTARFTLR
KFDFSPSSNDLLTNGEFRDWANEVWEKNKTGPLTIATGNVAAWLSFPVISERYEEVATLL
EEQDHAAYLPEGTDETVAAGYAAQMKSYAEALRSNHTAFYNLVFTAGPSNGILVDLHPLS
RGTINVDPKDPEGNEPLVDYRALSNPLDSVIMADILRYTRKFYMENSVNAEYDPVESQPG
ARVQTDEDMAAYLQQTLSPTEYHPAGTCAMMPLELGGVVDEQLRVYGVKNLRIADASIIP
TLPGANTCQTVYAIGEKAADLIKAGASSGDAEEVEEPTPEGPEADAPEAEGPEEPEPEEP
ESDE

Enzyme Prediction     

No EC number prediction in jhhlp_008371-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	42	624	2.6e-166	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.06e-92	36	626	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.08e-90	40	623	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.30e-36	478	618	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.60e-29	110	351	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	9.73e-11	42	615	55	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80399.1|AA3_2	2.23e-275	22	626	18	631
CDP28753.1|AA3_2	2.03e-266	22	617	18	619
AEO63808.1|AA3_2	1.35e-259	9	625	8	637
QBZ55222.1|AA3_2	6.83e-236	8	625	11	654
QBZ63758.1|AA3_2	8.74e-203	20	625	21	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.18e-111	39	623	2	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	8.19e-109	9	622	4	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	3.95e-68	43	624	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.10e-67	43	624	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	1.15e-61	42	628	5	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	3.66e-96	30	623	25	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.03e-81	42	623	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	2.99e-76	42	622	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.99e-76	42	622	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q5B8A1|PKFF_EMENI	1.04e-69	42	625	40	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000766	0.999210	CS pos: 22-23. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008371-t41_1-p1.