CAZyme Information: jhhlp_008362-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008362-t41_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	NLAX01001623|CGC16	32056.06	4.7658

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:538909-539875(+)

Full Sequence      

MFFTLTRAKAALSLLAFFSTGYAGSSKQITEWGDNPTNLGAVIVYTPDTVAENPAVVLAL
HPCGGTGQMYQSMTGLNKYADDHGFIVLYPTSKSQNGMNCWDAHSEKSLKHDGGGDSQGL
AGMTKWAIETYNGDPEKVFVVGGSSGAMETNVLAATYPDLFKGAISYSGVPAACWAGSPI
STPLSSDLSCPLGQKASTYTADQWAELAKSCYPGYDGPYPKMMIIHGTADTAVTVNNLAA
QLSQWATVKGLEFSKNVTDDPIARWKKIEYGDGTELVGYEVQGGGHIPPFQGALAMEFWG
LA

Enzyme Prediction     

No EC number prediction in jhhlp_008362-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	244	1.6e-22	0.8061674008810573

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.06e-25	3	289	5	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.21e-19	45	242	6	195	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	1.01e-08	124	242	52	170	Prolyl oligopeptidase family.
224423	DAP2	4.46e-07	2	237	340	569	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223477	YpfH	3.16e-06	51	172	13	135	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7030940.1|CE1	1.09e-83	13	291	10	285
UQC91056.1|CE1	2.81e-83	5	301	4	292
VBB78227.1|CE1	9.12e-82	9	301	4	290
CAE75726.1|CE1	3.67e-81	5	301	2	290
AFU88756.1|CE1	5.19e-81	8	301	3	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.43e-66	23	302	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	6.51e-82	5	301	2	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|Q9HE18|FAEB_TALFU	2.25e-75	23	301	18	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	5.19e-75	12	301	7	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|G2QND5|FAEB_MYCTT	1.42e-72	5	301	2	290	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|A1CSZ8|AXE1_ASPCL	3.38e-72	1	302	11	307	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000561	0.999406	CS pos: 23-24. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008362-t41_1-p1.