CAZyme Information: jhhlp_008347-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008347-t41_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	NLAX01001623|CGC15	47854.63	5.0836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:475452-477005(-)

Full Sequence      

KFPGIIFPELLGAWVDIVVIAAKVCTEEALLKRTPADGQVEGNSYADTMPLEEHGLKSAD
VHDKVQRLIRELVNIKDTTGEFLLKLDDGRIIDTKGWNDWEWTHGVGLYGIWKYYEMTGD
PEYLEIIESWFRNRFAEGHKGKNINTMAVFLTLAYVYEKTGNQTYLPWLDSWAEWAMHDL
GRTKYGGMQHTTYLEINDEQLWDDTLMMTVMPLAKIGLVLNRPHYVAEAKKQFLLHIQYL
QDSPTGLFFHGWTFADGGHNFARARWARGNAWVTIVIPEFVELLGLQSDDPLRFHLLNTL
DAQISALVPLQAENGLWRTLLDVPEEEGSYVEASATAGFAYGMLKAQRKRYVGKEYEATA
IRAIKAVIDNISPEGELLNTSFGTGMGHDLQHYKDIPRTSMPYGQAMAMMALVEFLRVYY

Enzyme Prediction     

No EC number prediction in jhhlp_008347-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	96	417	5.4e-107	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.67e-111	65	419	1	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	8.60e-103	74	419	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC83867.1|GH105	3.78e-239	52	419	7	374
UPK91701.1|GH105	1.60e-237	49	419	1	371
QKD46631.1|GH105	2.07e-233	49	419	1	371
QGI90529.1|GH105	2.94e-233	49	419	1	371
CCT63153.1|GH105	2.94e-233	49	419	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.58e-194	58	417	5	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	1.96e-161	53	420	18	381	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.03e-161	53	420	19	382	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	1.24e-17	100	369	23	300	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.55e-17	98	376	37	320	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	2.96e-48	100	417	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|O34559|URHG2_BACSU	2.34e-16	98	376	37	320	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.81e-09	217	363	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.81e-09	217	363	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	2.46e-08	202	364	201	369	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008347-t41_1-p1.