CAZyme Information: jhhlp_008318-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008318-t41_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	NLAX01001623|CGC9	47917.75	4.8076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001623:353671-355101(-)

Full Sequence      

MVKLIQSLLAAASFLLLSASALPSERRQEEAAASWPDAPFKVDGRWILNASGKNVTYAGV
NWSGHGEAMIPEGLQHQSVEYLVSKIKSAGINAVRLTFATEMIDDIYANDADTDIETSFI
KALGEENGRKVVAQILESNPEFTAQTTRLEVFDAVAAECAKQQIYVHLDNHISKAKWCCG
ETDGNAWWGDKEFPIDNWVRGLAYMAEHGKNWQALTSIALRNEPRNPSNNPAVAATYNWE
SWYKYVRQGTQAIFDANPNVLIFLSGLSYDTYIEPVFLGTALTPGNGRFSRDDFPGHADK
LVLEIHNYERSIGSCQSLSGNLYKKGFQAMHAEDPGTVNVFPTMLTEFGFPQDGAAHKDV
YAQCLSTYLPEQKAGFFYWVLTGSYYIRSGTQAYDELWGLLTADFKDWRDPAYINGPFKN
MVDGVKAYLD

Enzyme Prediction     

EC	3.2.1.164:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	381	1.4e-152	0.9940652818991098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.93e-05	48	383	1	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68439.1|GH5_16	6.98e-189	3	422	2	421
AEO58520.1|GH5_16	4.52e-179	33	422	25	417
UQC87314.1|GH5_16	1.43e-175	3	422	2	418
QBZ60790.1|GH5_16	6.01e-170	33	429	30	422
QKD50536.1|GH5_16	1.67e-167	32	414	27	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	7.19e-13	40	349	6	284	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	9.82e-12	40	349	6	284	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
3W6M_A	5.50e-06	59	269	32	223	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	7.29e-06	59	269	32	223	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	8.43e-06	59	269	65	256	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	1.28e-44	32	415	23	389	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	8.90e-11	40	349	47	325	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P04956|GUNB_ACET2	2.96e-06	42	317	44	304	Endoglucanase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999753	CS pos: 27-28. Pr: 0.3985

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008318-t41_1-p1.