CAZyme Information: jhhlp_008179-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008179-t41_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		70824.21	4.8007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001584:511006-513016(+)

Full Sequence      

MAFLQTSRTNAAVLLWLWLAQTITAQSSSDNLADKPRNDSYDYIVVGSGPGGGPVACKLA
RAGYSVLLVEAGNDQGANLNSEIPQLFPFAYVDTTMRWDYFVRNYDDEQRTLQNHHLTWL
RPDGTYYVGNDPPTGATLLGLYYPRGGTLGGSSAVNAMGSVLPSDSDWQMIADLTGDASW
NPGHMRDLFQNMELNHYLPPGTPGHGFNGYFHTNSAGQSVWDGYTDHLTVLGRIDESLGG
DADEILAAVTRDVNEHSATRDQDVGVTGQILHVDEKWRRFSSRDYILETAQAYPLTIKLN
TLATKLIFSDKPRKNKVIGLEYLEGQSVYRADPRNNGTQTGRVGKVFAKKEIILSAGVFN
SPQLLKLSGIGPARELRRLNVPVRVDLPGVGANLQDNYEVPIVGRAAKSFGAPAPDPEAP
ICTFGAPGDPCVDLWENGEGPYTNFGQVNSIFRKSSAPTFDERDFYANGGTFAIRGFWPP
TDSVTFDGPDTFALSTVKIHPRSKSGTVVLRTTDPRDPPEINFNLFATNDSKLDLDAYLD
TIKWARRVFASVPGPIGPIEPVEPPCNGAPAADGSCDDEADKEWVMNQVFGHHATSTCSI
GSVLDSKFKVLGVEGLRVVDASAFPRTPGPFPVLPTFLLSEKAAESILEDA

Enzyme Prediction     

No EC number prediction in jhhlp_008179-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	650	4e-91	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.99e-55	56	651	23	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.37e-49	141	648	80	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.48e-27	501	643	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.43e-20	274	632	215	561	Protein HOTHEAD
366272	GMC_oxred_N	8.69e-18	141	399	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP30361.1|AA3	1.25e-280	35	651	33	668
CAP67495.1|AA3	1.44e-279	35	651	33	668
VBB83559.1|AA3	1.36e-277	35	651	33	668
QRC93226.1|AA3	1.66e-194	17	651	11	666
VBB79663.1|AA3	3.03e-191	37	651	31	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.27e-30	41	650	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.55e-30	41	650	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4UDP_A	3.59e-26	41	651	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	3.59e-26	41	651	6	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4H7U_A	9.62e-26	7	647	10	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	2.01e-37	36	644	46	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.12e-35	42	648	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q8UH55|BETA_AGRFC	3.76e-35	42	648	4	526	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|A0A075TRK9|PATE_PENEN	5.88e-35	36	644	47	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	3.77e-34	38	648	2	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008144	0.991820	CS pos: 25-26. Pr: 0.9692

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008179-t41_1-p1.