CAZyme Information: jhhlp_008163-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008163-t41_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	NLAX01001584|CGC3	56419.05	5.2209

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001584:461591-463203(+)

Full Sequence      

MGLTAHAVVVQVKWSFSIPFSLAYFQQLIDIYYYRELAGMKLQSVIPFLGLLCGAALADM
VKDGSTCTVTPKSVLRKRHGLPEPPSNAPRAEVVDVHYERQGPYPRADPALGIPEKREPQ
FPGFPGGGGGGGGQASADDDTPALLEAFKECGQDGHIILEEGDYMIRQIMDTTNLRNVHI
DIYGHLEWSGDNIQYWLSNSISVTYAGRSTAWRIGGTNITMLGHGKALFFGNGQIWYDQN
RNQGNQNGRPISLTLWNANDIWIDGITWRQSQFWNTFIAHSSNVTMTNIDMNSTSASQWS
TVNTDGTNTWNSKDVYLQNWVVTAGDDCISVKGNSTNIHANNMTCYESGCMVVGSMGNPP
STPEYVENVVFENVYCHHSSNAAWIKTYPGTGYVRNVTFRNVAFDDINQPIYVSPCIYTG
QNCDSSRIPITDITWQNITGTARYNIAAGMYCSRSSPCDGFHFEDIDIRPLNGNGELKYL
CANIQNQATMGLECTGTLPANWPQQLDGNR

Enzyme Prediction     

No EC number prediction in jhhlp_008163-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	171	488	2.9e-62	0.8892307692307693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177865	PLN02218	1.65e-33	139	495	82	431	polygalacturonase ADPG
395231	Glyco_hydro_28	6.11e-33	197	468	22	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	3.36e-31	137	485	49	391	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	4.50e-29	188	481	128	406	Probable polygalacturonase
178580	PLN03003	7.43e-29	139	494	38	388	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06666.1|GH28	1.26e-194	135	509	32	402
AEO63358.1|GH28	1.73e-178	139	509	56	425
AEO56859.1|GH28	4.58e-134	139	419	53	333
QKX53026.1|GH28	4.56e-105	139	509	42	438
QKX63102.1|GH28	4.56e-105	136	509	38	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	5.96e-29	136	495	27	383	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	1.15e-12	183	489	53	335	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1RMG_A	1.84e-11	305	481	177	350	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	2.66e-61	135	496	41	417	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	3.98e-56	139	494	41	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	3.98e-56	139	494	41	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	4.50e-52	136	494	39	436	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	4.50e-52	136	494	39	436	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.917151	0.082841

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008163-t41_1-p1.