CAZyme Information: jhhlp_008150-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008150-t41_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31405.42	5.2041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001584:419710-420682(+)

Full Sequence      

MPMYKWFTALAAASVVAAADLKQVTDFGANPTKIQMFEYVPDVLTEKPPVIVNLHPCGGS
ATSWYRGTRMPSYADQLGFILIYPGTTNMNNCWDVHSPDSLTHGQGGDALAIVNMVNHVL
ETYGGDPERVYVMGSSSGAMMTNVLAGSYPDVFEAGSAYSGTAHACFAGAPSATPMSPNQ
TCAQGLTHTPEEWASFVHNSYPDYDGRRPRMQIWHGNADFLVRPQCAVEALKQWAAVLGE
TNTQNVTGVPSAAYTQIIYGDGSKLMGFFGQGVGHTAPVNEALTLKFFGLME

Enzyme Prediction     

No EC number prediction in jhhlp_008150-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	228	2.6e-25	0.7841409691629956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	9.57e-46	36	248	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	1.61e-26	27	239	40	236	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	4.76e-26	39	173	6	142	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	1.33e-09	45	162	391	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223730	Aes	1.65e-05	28	146	58	170	Acetyl esterase/lipase [Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57428.1|CE1	8.97e-157	7	291	7	291
CAE75726.1|CE1	4.47e-143	19	292	19	292
CAC05587.1|CE1	7.36e-142	19	292	19	292
AFU88756.1|CE1	9.92e-140	7	292	6	292
QBH73477.1|CE1	1.69e-138	19	292	11	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.20e-73	18	289	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	7.93e-144	19	292	19	292	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	1.25e-135	13	291	13	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	2.84e-100	15	290	15	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	6.19e-98	16	290	16	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q96W96|AXE1_ASPFI	4.01e-75	7	289	18	301	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000476	0.999485	CS pos: 18-19. Pr: 0.9370

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008150-t41_1-p1.