CAZyme Information: jhhlp_008111-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008111-t41_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	NLAX01001584|CGC1	45378.56	7.6279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001584:278123-279491(-)

Full Sequence      

MLTHFARPARRLTIAIALIIGLIFLFSRDHGIAARGMGSGPIDVFNSTLGFGKIFVVNLP
ERTDRRDLMTLAAAVTGLEFTYIPGVRGADIPEKVLPPSPRKKNVNWAGKTGSWRAHMNV
LQRIVQENLTSALIMEDDADWDIRLKSQAQTFAVASQAYLQPLQADPSHTLADLYPALSK
ILQEDNYVCDLQSAPATRAPSTSPYGDGWDVLWLGHVGSHIPSDWPSHQKNSDHPPLSLL
TLLVPDDGTVADKRHLKRHPFADRIDDFAARFESHTRVVHEARGTAGIQAYAVSQRGARR
LLLKFGLEEFTSSYDLMLRDWCDGAYVEDKGERPVCVTTQPPLMSQYYSKGGSDIHGIGG
GYFKKSGSTYIRHSVMLNLRKLVWRNTDRPGDIEGLVDQWPDEGKGPW

Enzyme Prediction     

No EC number prediction in jhhlp_008111-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	53	312	3.5e-27	0.9502762430939227

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.04e-26	53	142	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	3.29e-07	51	185	1	128	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79661.1|GT25	1.50e-115	16	404	13	397
QBZ63647.1|GT25	1.79e-110	46	401	43	391
CAP61640.1|GT25	2.11e-105	16	402	13	387
CDP27993.1|GT25	2.11e-105	16	402	13	387
AEO59316.1|GT25	3.72e-100	43	405	36	394

PDB Hits     

jhhlp_008111-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Q021|GLT25_ANOGA	3.63e-06	43	138	310	415	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.863637	0.136372

TMHMM  Annotations     

Start	End
12	34