CAZyme Information: jhhlp_008054-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_008054-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938		104609.76	3.6548

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001584:35105-38185(+)

Full Sequence      

MEGLFLYASLLIAGTIIPSANALRVSTADDGSSSLVFREGAFSVSNAIYSGSVGDKTLFA
ASADEHKRRVASTVRYTEVSPGVVQVDIVPLQDPGDELPAPDTPIEVGEPVPEVPEQGGG
LVPDVPIPDDPGEEAPGSDEGDVVIEDPEPEPEPEPEQPETPETPEPQPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPQPDPDQEPDPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE
KPETPETPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEEPQTPQEPEPIPEPEPE
PEPEEPFTGVITTSSFTFEEGDIIYGIWEYPFNGSIANHDITFEVKGLFGEQQGINYANA
RAPFFFTRSGFGVYVDTLAMGTFVFEGTTASFSFAADEEVSYKVLYNRDLKALLMEYAEL
SSKPELPPDSGYGPVFWSDNILRDFHGSVENAEENLYDIVDHLYYNEIRATGMFADRPYG
TGNMSFGNFDFDPEFFPDPEAFIANISEWGYDFQVWVANRAFLDTELYTTALENDWLFPG
IDGEEFLGPALDLTIPEAYAFFEERLRYFTDIGVKGFKIDRGEEHELPDELQNIQNTIFQ
QLCYDVMVEKWGVGNFFSFSRSVVDRARSLTAVWNGDSQADWEGLAFSVASGIRAGLLLF
STWGSDIGGYTRPDETTPGEELWARWMQFGAFSPHYEIMVGDGHTPWYDPYSSDLVEILK
KTAEWHTRLIPYIRSYTYQSTQTGLPVIRALFLEYPGDSKIYETGDAYAFGAEFLVAPFI
AEGGVRTVYFPDAGENSTSHKFVDWFNKTAVYEGGSEIEVALPLDEMPVYVREGSIIPTG
DIYQGNAKWIEEWKPTLEIEFYPSYAVEESRFEYLRADGEVAVITMRTNGDEETVLVQTD
ALGVEGVFKVYSKTGAAEIPFTADSMSFLMDKVATLFD

Enzyme Prediction     

No EC number prediction in jhhlp_008054-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	404	837	3.2e-83	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	4.63e-83	312	915	143	742	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.08e-75	404	837	2	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	5.83e-47	486	792	47	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
236731	PRK10658	2.88e-38	308	834	137	665	putative alpha-glucosidase; Provisional
269879	GH31_xylosidase_YicI	9.56e-38	423	729	2	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21215.1|GH31	1.17e-219	314	938	107	726
KAE8375447.1|GH31	1.92e-55	321	838	171	690
KAE8166388.1|GH31	4.76e-55	321	838	171	690
KAE8134669.1|GH31	8.72e-55	321	838	171	690
KAB8076399.1|GH31	1.18e-54	321	838	171	690

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7C_A	1.89e-47	353	838	229	716	Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	1.01e-40	363	880	197	728	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	9.72e-40	363	880	197	728	Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
2F2H_A	4.99e-38	321	897	159	725	Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	5.12e-38	321	897	159	725	Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AW25|AGDD_EMENI	5.23e-51	321	838	177	697	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	1.56e-37	363	842	189	679	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|P31434|XYLS_ECOLI	2.55e-37	321	897	159	725	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|P96793|XYLQ_LACPE	1.18e-33	324	891	160	737	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|P32138|SQASE_ECOLI	2.84e-30	418	835	241	666	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999675	CS pos: 22-23. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_008054-t41_1-p1.