CAZyme Information: jhhlp_007962-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007962-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881		97403.83	4.5929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001142:47578-50223(-)

Full Sequence      

MSYFVSRPGLRLTLLSLLLFLGSIPTGARSLTTRRDDEASAAGRERVSLNAGWKFQRFTE
NPDNLNYNTLKPWIMPAANNFIKDPARHTERPGDSPGDVNFAQASFDDEEWESLNLPHDW
AVKGPFYEGGNVPVGGSMGRLPIQGVGWYRRKIEVTDSDEGKAVYLEVDGAMSYATVWLN
GNLVGGWPYGYASFRLELTPYLEVGENQLAIRVDQALDSSRWYPGSGIYRNVWLTKVNPI
HVGQFGTWITSRDVSSDSATLDIVVQVENAATSGGDVEVQVVTDVYEYDASSDEPGENVG
RISNGTVIVGAGSIGSTNSSVTIQNPKLWGPRPSQEPHLHIAITRLYVDREEVDSYETKF
GIRSLQYDGDGLKVNGERVYLQGVCQHHDLGSLGSAFNIPAAERQLEMLQDMGSNAIRTS
HNPPAPELLDLADRLGFLVLDEIFDTWGSHKVSNDFQTIFNDWSEPDLRAFIRRDRNHPS
VWAWSYGNEVAEQGSSTGASVAQRLRDIVHEEDDTRKTTIGMNNAGPDTTFTSIVDIIGL
NYQGEGKGNGGPTFQNFRGKYPDKMIFSTESSSVVSSRGTYLFPVTDGNNAIVGRNGAGV
NPQTRQVSSYELYAVEWGASPDKVFAAQDRYPYVAGEFVWTGWDYIGEPTPYDSSRSSYF
GIIDLAGFPKDRFYLYQARWNPDVKMAHILPHWNWPDRVGQVTPVHVFSSGDEAELFING
QSQGRKKKEQFAYRFRWDDVTYEPGEVHVLTYKDGQEWANATINTTGEATKLQVSTYKDR
DSIRADGSDLLFVSVAVVDDKGSVVPDAEPAVTFSIEGPGEIVTTDNGDPTDMTPFPSKE
RKAFRGRALAIIRANTETSGTITLKAEADSLEGAEITVTVA

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	33	719	3.9e-115	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	7.59e-64	37	698	3	618	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	5.24e-46	148	541	68	470	beta-D-glucuronidase; Provisional
408349	Glyco_hydro2_C5	2.89e-42	772	877	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236673	ebgA	8.34e-34	100	516	62	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	5.95e-31	29	489	38	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP26753.1|GH2	0.0	39	880	27	868
CAP70161.1|GH2	0.0	39	880	27	868
VBB76852.1|GH2	0.0	39	880	27	868
QBZ63581.1|GH2	0.0	37	875	76	923
AEO59435.1|GH2	0.0	27	878	29	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	6.63e-198	97	880	39	820	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	4.15e-171	46	878	3	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	6.14e-169	43	871	6	798	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	9.90e-143	99	878	24	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	2.07e-142	99	878	47	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	2.91e-181	102	878	62	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	2.64e-109	94	857	61	798	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	9.27e-59	105	819	49	737	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	1.20e-51	98	729	69	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.18e-49	96	823	16	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000699	0.999238	CS pos: 28-29. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007962-t41_1-p1.