CAZyme Information: jhhlp_007922-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007922-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	NLAX01001139|CGC10	97617.85	5.8419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:1723874-1726629(-)

Full Sequence      

MARYERIPHCYILEDESTSGETLSRSQASITLRSTDTSIPHPFVFGFEAVRDNVFHLSFT
SESHPSPPHPSIERFDAKLSTEPEIRLSSDKKTKKILTRLAEATIDWSGAPIVSISIDDA
DEPIYQDLPFRSYAADGTGVAHYTRYKRDTLHVGLGEKAAPMNLAGRSFTIATSDTFGYD
AYRTDPLYKHIPLLINVTRQGCVGIFSTSHARGTWNVGSEIDGLWGPFKVYRQAHGGLEE
YIIVGKTVEEVVRSFAEIAGFPLLVPRYMMGYIGGGMKYSMQDTPAAADAILDFLGNCEK
NDIPISAFQMSSGYTVAETEPKTRNVFTWNRHRFPDPRAFTRECHRKGVRLLANIKPYVL
ANHPEYGRLLESGSLFYDPATKASAVARLWSAGGGESGEGGHIDFTSQGGFDWWYHGCRE
LKKCGIDGMWNDNNEYSIPSDDWICALQTVSPFGEGMKDRHVGLWGRALQTELMGKSSYN
ACVDHAPNERPMVLTRSATAGTMRYACSSWSGDNVTSWEGMKGGNALSLNAGFSLLQCYG
HDIGGFEGPQPSPELLVRWVQLGIHSPRFAINCYKTSANDNLVGEVIEPWMYPSVTPIIR
QAIKRRYELIPYTYSLSILSHFTAIPSQRWTGWGHEDDPEVWTKAILNGDTQYWFGEAFL
VAGVYEPGATSARLYLPRNTSRDGQDLGFLNTNAPFQHLPSGKWHDVTAVWYDSIAILAK
CGTAVPVGKNRPTTCRVGIPEEEEEFPNIEKDDWRGLEIYPPPPLPGTGANLPFRSPITF
ENCWREDDGISAESQADICTIKVTYTVDMTPGDIIIAPVEVEKTRSWAPLWLHNGLDIIL
PVGDRRTVRSGDETVHAVYKGIDARGRAVWNIPSVAES

Enzyme Prediction     

No EC number prediction in jhhlp_007922-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	241	724	5e-96	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269885	GH31_glycosidase_Aec37	2.86e-146	260	603	1	319	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
395838	Glyco_hydro_31	3.27e-105	241	725	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	9.25e-103	30	730	18	675	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	8.09e-55	326	621	55	336	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269884	GH31_transferase_CtsZ	5.89e-46	260	616	1	329	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87212.1|GH31	0.0	5	873	6	871
AEO62178.1|GH31	0.0	29	867	22	849
UNI19522.1|GH31	0.0	1	872	1	850
UJO12672.1|GH31	0.0	1	872	1	841
UKZ72504.1|GH31	0.0	1	867	1	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B9Y_A	5.00e-38	153	806	155	732	Crystal Structure of Apo Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31 [Cellvibrio japonicus],4B9Z_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with Acarbose [Cellvibrio japonicus],4BA0_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with 5F-alpha-GlcF [Cellvibrio japonicus]
5I23_A	5.38e-38	153	806	132	709	Crystal Structure of Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31, in complex with Cyclophellitol Aziridine probe CF022 [Cellvibrio japonicus Ueda107],5I24_A Crystal Structure of Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31, in complex with Cyclophellitol Aziridine probe CF021 [Cellvibrio japonicus Ueda107],5NPB_A Crystal Structure of cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with alpha Cyclophellitol Cyclosulfate probe ME647 [Cellvibrio japonicus],5NPE_A Crystal Structure of cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with beta Cyclophellitol Aziridine probe KY358 [Cellvibrio japonicus Ueda107]
5NPC_A	2.20e-37	153	806	131	708	Crystal Structure of D412N nucleophile mutant cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with unreacted alpha Cyclophellitol Cyclosulfate probe ME647 [Cellvibrio japonicus],5NPD_A Crystal Structure of D412N nucleophile mutant cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with alpha Cyclophellitol Aziridine probe CF021 [Cellvibrio japonicus]
5IEF_A	6.52e-33	154	726	226	779	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	6.54e-33	154	726	226	779	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9F234|AGL2_BACTQ	3.11e-43	154	734	151	683	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q14697|GANAB_HUMAN	2.50e-40	154	726	258	811	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|Q4R4N7|GANAB_MACFA	7.72e-40	154	726	258	811	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|B3PEE6|OL4AG_CELJU	2.56e-37	153	806	155	732	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
sp|P79403|GANAB_PIG	6.59e-37	154	726	258	811	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007922-t41_1-p1.