CAZyme Information: jhhlp_007898-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007898-t41_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	NLAX01001139|CGC9	62725.89	5.2618

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:1624840-1626689(+)

Full Sequence      

MTIDGEYDFIIVGAGPAGSAVAYGLSVAAGKDAKILLIEAGGPNDDRNLRVDGQRWITFF
NEQMNWGYKTAPQVHCANREINYARGKGMGGSSAINFSFFTVGPKGDYDEWARLVGDQAF
SWKNMQARLKTLETFHLELPAGVDPKYASPRPGDHGDSGPLDVGYAREWEEDLVPLLGLF
EDAGYPLNQDHNSGNPLGMGLVINSAHAGLRSTAADLLKNVSEKNVTILTDTAVQRVVLD
GKKVIGVESSGKRYLASKEVILCAGTLDSPRILMHSGIGPGDQLRKFDIPVALDAPYVGS
GLKDHTFTLIAYKRTPESGSKRGNFYTDQVAMDAALEQWKKDGAGDWSKFACQAGIGFFK
LPDTFTSSAEFLALPDTVKEHLNHETVPHFEVVTHIPQHYFLPDFAKDDKESYDYMCFGA
MLLNGQGQGNVTLQSSDPNVPLLFDPKFLEHPFDRRAAIETLREVLKFTKIPAFAKDTLA
TIAAPKSDSDEDILEYCRQTLTTTWHMTGTAKMGRRGDEDAVVDSEFRVIGIEGLRVADM
SVVPVMANCHTQAVAYLTGLTCAERIAKSYGYI

Enzyme Prediction     

No EC number prediction in jhhlp_007898-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	568	2.1e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.52e-88	1	568	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.55e-87	6	567	5	528	choline dehydrogenase; Validated
274888	Rv0697	4.35e-52	8	567	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.65e-35	429	562	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.85e-34	4	542	53	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33321.1|AA3_2	7.08e-267	3	570	1	561
QMW45359.1|AA3_2	1.00e-266	3	570	1	561
UDD61192.1|AA3_2	1.00e-266	3	570	1	561
QRD84914.1|AA3_2	1.36e-265	3	568	1	559
AEO58638.1|AA3_2	3.63e-262	6	571	4	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	3.10e-56	6	570	40	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	2.89e-53	6	566	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	3.92e-53	6	566	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
2JBV_A	3.13e-48	4	569	11	529	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3LJP_A	3.13e-48	4	569	11	529	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1QXE1|BETA1_CHRSD	1.48e-57	1	566	1	535	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	4.03e-57	3	566	1	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	4.03e-57	3	566	1	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P64264|Y1310_MYCBO	4.03e-57	3	566	1	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.58e-56	4	570	38	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000030

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007898-t41_1-p1.