CAZyme Information: jhhlp_007885-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007885-t41_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		51302.91	4.7978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:1573983-1575508(-)

Full Sequence      

MRLLPIAGFLQLLPLLRGVKAELRSSKDPQIPSKYPIGHVDEPFAKPAGRVFEVNGTVKY
MTGTNAWYLNRLDEEDLEITLKQIIDASSFPSLFLPLFLIFAGKGRPCNRKAGPVKLSGY
ELIRVWAFGEINELPNPKASEPAPMSVFFHYLNETGGYINYGPEGLDRFDRLVSRCEDLG
LKLVLPLFNQWSDYGGAPLYISTYSDTWTERWIEFPKAQEVYRDYVKVIVERYKDSPAVF
SWQLGNEPRCEGCDNLEKLVDWARNVSAYIKELDPEHMVSMGDEGWLTPREREQGYGDKG
TGYNGNNGVDWVSIMGIETLDYGTVHLWPDHWAYPYEWGVQWIEDHDKLAAQFNKPIILE
EYGAAKRDGHIEPLLPWQDALLNSGFAADQTWQFEPDGTSFTNFPDPQFAIHYGSEEWSV
LAKNHSLRVDAKTKALQLGSSEVSEIRIHH

Enzyme Prediction     

EC	3.2.1.78:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	117	394	4.3e-71	0.9550173010380623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	1.15e-28	157	366	58	248	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	1.71e-08	143	369	43	243	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	2.15e-04	221	265	107	160	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
404153	DUF4038	2.65e-04	167	287	84	196	Protein of unknown function (DUF4038). A family of putative cellulases.
397119	Glyco_hydro_2_C	4.79e-04	216	365	104	213	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD53723.2|GH5_7	9.47e-106	8	432	7	394
ATZ55503.1|GH5_7	9.47e-106	8	432	7	394
APA12777.1|GH5_7	4.28e-104	45	426	43	388
CCA94935.1|GH5_7	6.05e-104	35	429	36	393
QSZ30248.1|GH5_7	2.66e-103	45	426	43	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QNO_A	2.70e-73	44	425	4	339	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3ZIZ_A	3.18e-72	45	431	16	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
3WFL_A	1.04e-68	42	421	1	334	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
3WH9_A	5.30e-66	44	425	2	338	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
4AWE_A	1.99e-58	40	429	2	381	The Crystal Structure of Chrysonilia sitophila endo-beta-D-1,4- mannanase [Neurospora sitophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B833|MANB_EMENI	1.89e-94	36	432	26	382	Mannan endo-1,4-beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manB PE=1 SV=2
sp|B8NIV9|MANF_ASPFN	1.35e-75	44	430	119	461	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manF PE=3 SV=1
sp|Q2U2I3|MANF_ASPOR	2.68e-75	44	430	119	461	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manF PE=3 SV=2
sp|Q5AVP1|MAND_EMENI	1.03e-72	49	442	32	378	Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manD PE=3 SV=1
sp|Q5AR04|MANF_EMENI	1.56e-72	44	432	90	433	Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000481	0.999484	CS pos: 21-22. Pr: 0.9341

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007885-t41_1-p1.