CAZyme Information: jhhlp_007871-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007871-t41_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	NLAX01001139|CGC11	99589.74	5.0885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:1526766-1529534(+)

Full Sequence      

MARKQHNLNSWQWRAGNTNGVAQADSLKEWKPVQSFPSVIQMELAANKLIPDYNIGENER
QIQWVGEVDWEYQTSFSTPEDANAENVDLVFEGLDTVATVTLNGAEILKSDNMFVPARVA
VKQHLKPVGETNELHIAFESPVKAGLALEEKHGARKSMMRDKKRMHLRKAQYSWGWDWGP
IVLTSGPWLPVYLDTYDTRIDSVYVRTTQTEDHSSSQVTVNVEVANPKKGASAKVTVADG
ASTEVGSATVELDDSGKGSVTFDVKLPKLWWPNGQGEPHLYTAKVVLTGSDSAIVDETAT
RFGIRTIEIIQRPLKDAPGTTFMFRVNGRDIFSQGGDWIPADNLLPTISRERYFEWVRLA
KFNHLNMIRVWGGGIYETDDFFDACDENGMLVWHDYAFACGDFPTHDDYIESVRKEAELN
TKRIRNHPSLALLCGGNEDFMLNDWEKVEYDHADLTGPFDNTNFPQRKIYLDLLPKVAKE
VCPDVTYWANSPWGGATANDTTVGDIHQWSVWHLEQLPYQEYKNLSGRFVSEFGMHGFPI
KRTVDHFTRGAKPEQCHPQSRLIDCHNKGHGAHTRIARYLAENFRFDMTNLDNFVYSSQL
MQSEAYGCALRSWKRLFNGEGEEKCAGAIIWQFNDVYPVTSWAYVDYFLRPKPAFYSIRR
EFAPLSVGVERTPWTRWVDEDKPNASSIPGFDIFAHNTTPNDVTCDLVLRAYDFATGKYT
VLPAEDAKRSVTLKAGRNNELGSLKKQNSWTEDSLVILELTLVESGSGKELARFVDWPEP
YRYLYWPAGTDVAIKLDEAGENADGWENVVTISSEQPLKGVWLEPVYDGTEKDEDPEPLW
EDNMVDLVPGSERNLRVKGLKGRKVKARFLADWEVKKA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	678	3.4e-93	0.6183510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.87e-73	35	678	29	646	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	8.16e-15	198	305	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.49e-10	72	438	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
236657	PRK10150	2.61e-09	3	309	10	280	beta-D-glucuronidase; Provisional
407658	Mannosidase_ig	5.10e-06	691	783	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00148.1|GH2	0.0	8	876	8	881
QBZ55906.1|GH2	2.10e-225	9	861	12	845
CCD56258.2|GH2	2.51e-223	25	870	20	853
ATZ49691.1|GH2	1.48e-222	25	870	43	876
UQC87618.1|GH2	7.80e-222	33	870	53	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	6.03e-125	28	858	41	811	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.35e-114	28	855	23	814	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.46e-114	28	855	25	816	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.52e-114	28	855	25	816	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	6.55e-114	28	855	23	814	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	2.77e-219	32	870	27	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	2.42e-190	30	861	26	832	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	2.42e-190	23	861	19	832	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	4.82e-190	30	861	26	832	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	9.60e-190	23	861	19	832	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000001

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007871-t41_1-p1.