CAZyme Information: jhhlp_007851-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007851-t41_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828	NLAX01001139|CGC2	90701.21	5.4502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:1469925-1472515(+)

Full Sequence      

MNYTTLLPQLKLEEKIALLSGRDFSNAAGVPRLNIPPTRVADSINGVRPSNIAGSETTAC
FPNTTCLASTWDRTLLADLGIHIARQARLKSAQVVLGPTINIHRDPRAGRNFECWSEDPV
LTGELAAALVNGIQGAGVGACAKHFVCNDSETARHGYDVKESVDSRTLREVYLAAWQVML
RKSNPVGVMMAYNKVDGQFCSENYALLKILRETWGYKGIAMSDWFGTRSTVDSIKAGVDL
EMPFPIFRGQRLLKAVKEGQVSEEEIDRRAEKMLELRDRTRECQSEAPERCEEYEDTNML
ARKLAAAGIVLLKNEGHVLPIEPSGNPKKIALIGEYVKNAVVTGGGSASCRPQYRQTPLE
VLPKLLPEPHSVQYAPGVRTNVIIPMAPTEKLTSPEGKPGARVDYYNQDTAEPVYTESLE
KPVVFMLDKLRPGLQPLGSRLEMTTSLVSETTGEHTLAVRCTGAFSLYIDGAEKVTGPEP
KITTEQFIFCPILIETRLKISMNAGQQYSIKLVMQAREKQVVGEPTPYGATLCFEEYVDE
NAAISQAAELARNSDISIIYAGRSDQYESEGFDLKDISMPANQTALIKAVAAASKKTVLV
LHCGNPIDVSPFINDVDAVLNAHFPGQEGAMAVAEVLTGAVNPSGRLATTWFKSLDDVPS
HEHFPAKPTAEGKMEISYTEGLEIGYRCREAGKKARWPFGFGLSYTKFEYRDFKARVAGE
DGDTATLECSVAVTNAGSRAGKEVVQLFVAPAEAPIWRPEKELKGFTTVELEPGESKEVT
LSTALDTTCSYWDEGAKVWKVEPGEYGVYVGGCFTTFRVAQGKSWNHL

Enzyme Prediction     

No EC number prediction in jhhlp_007851-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	243	3.8e-57	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.05e-71	4	811	39	751	beta-glucosidase BglX.
224389	BglX	5.36e-61	22	350	47	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.62e-51	5	811	55	769	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	8.25e-48	519	686	53	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.49e-39	32	276	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84261.1|GH3	0.0	2	811	872	1675
CEI65540.1|GH3	0.0	2	828	10	835
QKD60029.1|GH3	0.0	1	811	1	812
CCT73941.1|GH3	1.63e-315	1	811	1	803
QGI86914.1|GH3	1.63e-315	1	811	1	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.44e-133	6	811	9	822	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.16e-129	6	811	9	822	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.32e-120	6	811	8	654	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.61e-102	10	811	12	649	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.19e-101	6	811	7	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.10e-155	5	811	13	824	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	5.27e-152	6	820	5	805	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	6.02e-149	14	811	24	815	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q4WU49|BGLI_ASPFU	7.60e-142	7	825	10	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.60e-142	7	825	10	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000052

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007851-t41_1-p1.