CAZyme Information: jhhlp_007692-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007692-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		60724.34	4.9621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:782151-784082(-)

Full Sequence      

MATFCRAILLTTALFTGAALGVDTHGSGGTVDEGACPDYSSYSKYPHPPFSEGTYRLPFQ
RPAEQCRTFSSRAIEKVIEDITSRMKDPDLARLFENTFPSTTDTTIKFHTDGKSLRFMDT
NPGSFIDEGKWEGPQTFVITGDINAEWLRDSTNQLSPYQFLAKSDPNLHTLLVGAINTQS
EYVIESPYCNAFQPPPLSNLAPSSNGQDDTVHPMYEPNFVFECKYELDSLAHFLALANSF
YEHTGSTEFVNPRWLTALERLLEVLEQQSQPTFDPLTGRHLRNEYTFQRRTDLGTETLNL
KGIGNPLNNGTGLVRSAFRPSDDATILGFFVPANAMMAVELRKTGEILKAVDKPDLAGSL
MQLSQRISKGIWDHAVVDHAKYGKVFAFEVDGYGSHILMDDANYPSLLALPLMGFLERDN
PVYQNTRNMLLSLNSNPYYLTGRDFHGIGGPHIGVNNAWPMSLLIQAQTSDDDNEIEECL
QLVLKSARLGLMHESVDVNHISSYTRSWFAWCNGVFAETILDLAKRKPHLIFTDSTPYAG
PQII

Enzyme Prediction     

No EC number prediction in jhhlp_007692-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	87	521	1.5e-163	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	87	521	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.45e-172	66	530	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC89947.1|GH125	2.44e-275	32	538	562	1068
QPC60340.1|GH125	2.10e-272	36	532	36	534
CEI62897.1|GH125	3.46e-271	36	532	36	534
QPC71621.1|GH125	3.46e-271	36	532	36	534
CZS82509.1|GH125	3.46e-271	36	532	36	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	5.14e-101	61	525	23	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.30e-99	61	525	43	470	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.69e-99	61	525	21	452	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.24e-74	74	527	12	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QPF_A	1.36e-74	69	522	3	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.08e-191	35	531	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999780	CS pos: 21-22. Pr: 0.9642

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007692-t41_1-p1.