CAZyme Information: jhhlp_007665-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007665-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	NLAX01001139|CGC3	79197.80	4.4607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001139:670720-673326(+)

Full Sequence      

MEKLVETRQPGVDAVMADSAAVSQEGNVVNEHDALPDDVEFQFNVEETLKKLLDQEDTDN
NMQITTEDIELSTTDGIPYTVRGSYMLSNLLQELTIAKDDGLAELSVSLARLNENPVRRL
ERRIADAFWDKLTRRIDASTVEIAAVDPKDWTDDPRPRIYVPHGEPGQYEFYKKVAEDRP
EIRLDVQMLPEDITPELLRDLSRKPGLLAIAMEEVDDPATEGGKTLRGVPFVVPGGRFNE
FYGWDSYFESLGLLVNDRVDLAKGMVTNFCFCIKHYGKILNATRSYYLCRSQPPFLTDMT
LRVYERIKDEEGSKDWLRGALLAATKEYFAIWAAEPRLNPETGLSRYLPEGLGVPMETEH
GHFMHVLTPYAEKHNMTYDEFVEAYTWGKIKEPELDTYFEHDRAIRESGHDTSYRLENRC
ASLATVDLNCLIYKYETDLAKAIRTHFDDSFAVPEEYCVGELQPGQTLTSAFWEERAEKR
QQAIQKYCWDEERGWFFDYDVDKKERTGYESATTLWSLWAGVATKEQAATLVEKALPKLE
AFGGLVSTTEDSRGELGPDRPQRQWDYPYGWAPQQMLAWEGLSRYGYPDVAARLAYRWLY
MMTKAFRDYNGVVVEKYDVTREEDPHRVDAEYGNQGLDFKGVAKEGFGWVNASYVVGLKV
VGEELRKGLEEMIPYDEYQKKAAAATTSVAEAA

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	113	659	2.6e-151	0.9653767820773931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	0.0	107	662	10	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.47e-176	43	667	11	558	Neutral trehalase [Carbohydrate transport and metabolism].
215307	PLN02567	8.17e-58	107	651	50	534	alpha,alpha-trehalase
237326	treA	3.06e-52	230	661	149	533	alpha,alpha-trehalase TreA.
183934	treF	4.16e-48	230	651	161	536	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO56949.1|GH37	0.0	30	680	73	730
AEO63461.1|GH37	0.0	30	680	81	738
CDP26053.1|GH37	0.0	30	678	78	733
VBB76134.1|GH37	0.0	30	678	78	733
CAP73650.1|GH37	0.0	30	678	78	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NIS_A	3.62e-256	45	674	7	638	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5JTA_A	4.89e-255	41	674	98	733	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	1.89e-253	41	674	103	738	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5M4A_A	1.49e-244	86	674	3	585	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	4.32e-43	230	651	115	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A384JRP0|TREA_BOTFB	0.0	41	680	77	723	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42783|TREB_NEUCR	0.0	30	680	72	730	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42622|TREB_MAGO7	1.38e-318	32	680	67	722	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|J5K1E2|TREA_BEAB2	2.45e-314	41	680	79	729	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1
sp|O42777|TREB_EMENI	2.08e-305	41	684	89	739	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000002

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007665-t41_1-p1.