CAZyme Information: jhhlp_007520-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007520-t41_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	NLAX01001036|CGC1	46569.21	4.1191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001036:304107-305536(-)

Full Sequence      

MRPAILSLFLAAGAVAAPRRPCNHDSGRGRLSAASRPHRGPSGPKRPIPETTKVVVSQPD
ETEDSSPEIVATQAPVINGSEEASSPEVTVPEDSEDTEETGSTDDSEKPATQAPATDKPT
TETPAADTPATGGPTSISGLPSCWAPGVKWQIVIDDPVDITKALNPPDAQVWVVDYFHSV
ENPDIIPHLKSPTSGADNVVLCYMNIGAIQQSESDYSSFPSDAIGNSYDGYPEWWIDTSR
SDVIEFMKKRIAKAAEVGCDGIDGDNIDGWDADGAASGDKTGFGLTKAQSITYIQTLASY
AHSLTTKRGLPLMFGQKNSQQLIPDVADYVDFAVLENCQASGDWCGEFQGFITGAARSDG
AKMPVFDIEYPSSASDATAVAEDDWQHYCNRDPAVVGNAGFSTIIKRESGQLDGFVQYCE
TTADKGVYTTNMIQWN

Enzyme Prediction     

No EC number prediction in jhhlp_007520-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	150	370	2.4e-41	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	1.26e-56	149	406	1	215	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.99e-06	200	276	105	186	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
223021	PHA03247	2.07e-05	2	171	2632	2818	large tegument protein UL36; Provisional
411474	fibronec_FbpA	1.59e-04	34	130	161	250	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
223021	PHA03247	0.002	9	147	2732	2859	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97753.1|GH114	3.20e-58	146	419	37	305
AEO68168.1|GH114	3.38e-56	140	420	24	312
EAQ83415.1|GH114	3.38e-56	136	419	13	310
QKD47958.1|GH114	3.85e-56	142	419	35	307
QGI89288.1|GH114	8.39e-56	142	419	51	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	7.09e-27	144	419	34	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	9.95e-27	144	419	51	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

jhhlp_007520-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001616	0.998349	CS pos: 16-17. Pr: 0.9657

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007520-t41_1-p1.