CAZyme Information: jhhlp_007495-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007495-t41_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	NLAX01001036|CGC3	51566.69	4.3332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001036:219043-220666(-)

Full Sequence      

MRGISQLSLGLVAALAARAHAACTGLLQLEAEDAVLSGTEVLTELAGYSGSGYVGGFDES
ADKITFTVEVTEEKLYDLTIRYAGIYGAKRATVTLNSGISFEVPFEETTSWETASGGQVL
LSKGENTIQIVNNWGWYLIDYVALKPSAARADHQITDTLVNPDADANAYTLYRYLKSIYG
KKILSGQQDLTWADYAANKAGKYPALLSVDLMDYSPSRVERGTVGTSMEDAIAHHNKGGI
VSVLWHWNAPTGLYDTEEHKWWSGFYTDATDFDIDAALSDTTNANYTLIIRDIDAIAVQL
KKLETAGVPVLFRPLHEAEGAWFWWGAKGPAPCLKLWKLLHDRLTGHHGINNLIWVWNSI
SADWYPGDDSVDIVSADVYSQGNGPMAIEYDQVIALGKDTKMAAATEVGAAPLPSLLQAY
QAHWLYFCVWGDSFINNDDWNSAATLTEIYNDEYVLTLDEIQRWQDSV

Enzyme Prediction     

EC	3.2.1.78:14	3.2.1.151:5	3.2.1.4:3	3.2.1.78:13	3.2.1.151:5	3.2.1.4:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	160	460	2e-104	0.9966996699669967
CBM35	30	143	3e-32	0.9747899159663865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396639	Glyco_hydro_26	1.11e-78	160	460	1	311	Glycosyl hydrolase family 26.
271152	CBM35_mannanase-like	8.32e-39	29	145	3	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
293595	CBM_35	6.21e-17	30	146	3	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
226609	ManB2	3.12e-14	285	424	159	307	Beta-mannanase [Carbohydrate transport and metabolism].
271143	CBM6-CBM35-CBM36_like	8.52e-13	28	144	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG24384.1|CBM35|GH26	8.56e-234	30	467	50	487
AAQ31840.1|CBM35|GH26|3.2.1.78	1.21e-233	30	467	50	487
AEO53670.1|CBM35|GH26	5.63e-233	30	467	45	482
VBB80704.1|CBM35|GH26	1.63e-224	30	465	33	468
ADO14135.1|CBM35|GH26|3.2.1.78	3.20e-224	30	465	13	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	2.00e-225	30	467	16	453	Chain A, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.01e-102	158	461	5	310	Structure of Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	4.04e-50	152	464	27	355	Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	2.89e-43	160	462	24	328	The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	8.99e-43	146	438	31	322	The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q4H7|MA26A_MYCTT	9.99e-234	30	467	45	482	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
sp|P49425|MANA_RHOM4	1.69e-102	25	468	15	464	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
sp|Q5AWB7|MANE_EMENI	8.63e-92	160	464	29	353	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
sp|P55298|MANC_PIRSP	4.25e-84	30	461	24	459	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
sp|P55297|MANB_PIRSP	4.82e-83	30	461	25	461	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000385	0.999582	CS pos: 21-22. Pr: 0.9665

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007495-t41_1-p1.