CAZyme Information: jhhlp_007329-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007329-t41_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	NLAX01001034|CGC2	43678.55	5.1135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001034:1548263-1549552(-)

Full Sequence      

MKSLITFALAASLAVEAVAQPHHDHRGIHRSLKRRAASKVRREPAVVTEWVASSTETVYK
LDGETISKEEADKGLKNGDLVIIGETTPKIEPEQGAQFYEKKPETTSTPTPTPTPEPTPE
PSQSSSSGGKGLTAEFPSGTIPCSQFPSDYGAIPISYLGTGGWTGIQRCPSYKSGDSSIS
YIETGIKGDGCVSGAFCSYACPPGYQKTQWPKAQGSTLQSIGGLYCNSDGYLELTRANHP
TLCEEGAGGVFIQNDLDQVVSTCRTDYPGTEAMVIPTVLNPGEKQPLTNPSSSSYYVWND
MPTTAQYYVNKKGVSVEDGCVWDSSSNHDERGNWAPVNIGTGKSSDGITYLSIFPNSPTT
SAKLDFNIEITGDVSIKCKLVNGAYTNGNSAGCTTAIRDGGVAIIRYYQ

Enzyme Prediction     

No EC number prediction in jhhlp_007329-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	112	406	7.8e-103	0.9306930693069307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	5.70e-142	138	394	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC80645.1|GH132	1.57e-158	1	409	1	438
UPK97954.1|GH132	1.52e-143	1	408	1	437
QPG99169.1|GH132	1.62e-141	1	408	46	494
CEF73471.1|GH132	4.92e-141	1	408	1	443
QPC67105.1|GH132	4.92e-141	1	408	1	443

PDB Hits     

jhhlp_007329-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	2.57e-87	131	407	141	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	6.34e-78	128	409	170	449	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|P53616|SUN4_YEAST	1.66e-73	135	407	162	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|O43015|YBOH_SCHPO	3.05e-69	136	400	59	312	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|B5VMJ0|UTH1_YEAS6	4.19e-68	133	407	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000357	0.999617	CS pos: 19-20. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007329-t41_1-p1.