CAZyme Information: jhhlp_007253-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007253-t41_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		48724.36	4.4225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001034:1245281-1246753(+)

Full Sequence      

MKLPWLSAAFVLVCSGIAAPAASENGEPATLASVPLNFTTGPLPNDGSSVHTFSKAVTGT
YKNALYFTNWGIYGANFQPQDLPAGEITHVLYAFADIASDGTVISSDPWADTDKRYDTDS
WNDVGNNVYGCVKQLFLHKKKHRNLKLLLSIGGWTYSPKFAPIAATEEGRRRFATSAVRL
VADWGFDGLDIDWEYPQNAAEAQNLVDLLRSCREALDAYSAEFAGGYHFSITVASPAGAQ
NYDTMLLEEMNPLLDAWHLMAYDYAGAWDTTTGHQANVYPDPNNAAATKFNTETAVNAYL
QRGIPAEKIMMGVPLYGRSFMNTQGMGLPYSGIGAGSIEDGIWLYKDLPRPGAQEVWDDV
VRAAYSYDSSSQELVTYDTITSTSRKAEWLIEKGLGGAVFWEASGDRKGSESLITTLANT
MISLDGSQNLLSYPDSIYDNIRNAME

Enzyme Prediction     

EC	3.2.1.14:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	61	413	6e-76	0.9594594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	2.52e-123	66	406	4	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	3.09e-116	66	406	5	334	Glyco_18 domain.
395573	Glyco_hydro_18	2.27e-88	66	406	5	307	Glycosyl hydrolases family 18.
225862	ChiA	4.75e-88	54	418	31	433	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	5.94e-88	66	401	4	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70479.1|GH18	5.45e-196	21	445	66	487
EAA36073.3|GH18	1.52e-194	50	442	28	420
QBZ56002.1|GH18	1.50e-183	42	436	99	495
VBB72338.1|GH18	1.04e-176	31	445	81	500
ADF57309.1|GH18	1.30e-168	29	445	10	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EPB_A	3.35e-157	44	445	22	422	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
1D2K_A	3.05e-155	59	445	1	390	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
6IGY_A	4.01e-155	54	442	9	400	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
6YLJ_A	4.43e-155	44	445	22	422	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
1LL7_A	8.70e-155	59	445	1	390	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9ERT9|CHI1_METRA	1.43e-165	36	445	15	423	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P32470|CHI1_APHAL	2.11e-162	61	445	38	422	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P48827|CHI42_TRIHA	3.98e-155	44	445	22	422	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|P0CB51|CHI1_COCPS	5.25e-154	59	445	36	425	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	5.25e-154	27	445	16	425	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001158	0.998794	CS pos: 22-23. Pr: 0.7501

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007253-t41_1-p1.