CAZyme Information: jhhlp_007240-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007240-t41_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		31417.91	4.2697

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001034:1210121-1211097(+)

Full Sequence      

MFRSLFFLALAQAAFALPAAEPSCPVVFDGRVPADAEPTDFDANNGGGWMPFNSGYVKGE
TLKWSEILQFPEVAEASRFDADAGTIPVEVTLSDKSIFMTQNGFRRAGLQFLKDTNEGSP
ATTGKKTIHFSLRTDPQRTLNLTHEYILVWHETAAYDANQFNFQTGTILGQTGLPAETYK
LLDRSNKQLWSTPIKDDTWQNFAITIDYTANTLQMWYSEGDAELAKATDPINNNNAGEGQ
YQVGMLKKPTGTSDVVNSGYQESGLDEGLIYGGIFIEDSASDCVSK

Enzyme Prediction     

No EC number prediction in jhhlp_007240-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	26	281	1.7e-72	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.71e-95	26	281	1	250	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91234.1|GH131	2.70e-126	20	285	78	342
UQC86340.1|GH131	7.22e-119	19	285	25	300
QGI96469.1|GH131	2.30e-118	12	285	21	293
QGI65589.1|GH131	2.30e-118	12	285	21	293
QGI82835.1|GH131	2.30e-118	12	285	21	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W9A_A	6.63e-06	190	247	147	205	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

jhhlp_007240-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999757	CS pos: 16-17. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007240-t41_1-p1.