CAZyme Information: jhhlp_007091-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007091-t41_1-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	NLAX01001034|CGC7	48175.41	6.4983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001034:557038-558503(+)

Full Sequence      

MKWKRKFACAGISLCLLLLLCWFDLFYTEDPALGEYKLIIEEHLSRLGIGAEKDPEVQHQ
ENLKKAPKYVASILDPSNHNFKQLSCPPPNKKRYEHLIPSESATKPTYIFALNLINVAKL
LPRLMGSIVETLRFLGPENCVISIVEGHSKDGTMEILEALGPEITKLGAEYHFLRSEITP
NDGRRIAHLAELRNMALGPLLNNTAHFVEDPTIIFLNDVAICSEDILELIHQRRHIGADM
TCGMDWSHIKRYPTFYDAWVARSITGNSFFYINPEDISWDQAHLLFFDDPVGSKRLDDYR
PVQVFACWNGAVVFSARPLLKDGIRFRDGYEGECRMGEPTYFCKDLWKKGYGKIAVVPTV
NLEYDNKHGAWVKHKKGWVHKLVKEDDGAADLVEWRGPPEKVLCMPGWDQQTWVPWDEHT
P

Enzyme Prediction     

No EC number prediction in jhhlp_007091-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	108	348	5.2e-72	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	6.38e-93	107	342	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84687.1|GT69	4.13e-135	61	418	112	471
QLI67260.1|GT69	3.53e-131	68	418	64	417
UPL03918.1|GT69	1.79e-124	64	419	130	488
ANH56606.1|GT69	9.16e-123	68	418	76	435
QBZ56242.1|GT69	4.99e-121	74	418	1	367

PDB Hits     

jhhlp_007091-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	8.20e-50	17	418	40	466	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998400	0.001617

TMHMM  Annotations     

Start	End
7	26