CAZyme Information: jhhlp_007070-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007070-t41_1-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631		68214.84	4.2621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001034:472938-474894(+)

Full Sequence      

QSRTIVMHIKALTFASLLAVGPILAAPTARQESAADEYDYIVIGSGPGGGPLAVNLAKAG
HSVLLLEAGDTSAGGSSEYPPEITWDFFVKHFEDDERNKANDHGVWRTAEGRYWVGKDDP
PEGAEFLGIYYPRGATVGGSSMINAMATWLPTDSDWNYIVELTGDESWRAENMREIFARI
EKNNYLPEGTPGHGFDGWFQTMMTTGFGPPGSGGDGPANPITESMALELGLDPADVPELI
STDPNALDPDRDTTQGIWGLPRHQRANGERYSSRHYILESIDEGIPLTLSVNSLATRVLF
ETSETDEEANPRATGVEYLEGKAIYGADPRRGSDAEGTKKTATALREVIISGGAFNTPQI
LMLSGIGDPEQLEQFDIPVLVEAPGVGTSLMDNQEMPVVGQTAGSVGFGDPGFTMIQTEN
ATYGERDMFIMHFSGGVFRGFWPSNQTNTLPPEVPRVYGTSLVKQHPTNRAGYIRLQSAN
PLDTPDINFNLYVDGAEADLASMRNSVAWVRRVYANVAAPAGPVEPLEPPCPSGIKEDGH
CTNEAEDDEWIIGHTFGHHPTSTVRIGADDDPMAVLDSKFRVRGVDALRVVDASTFPRIP
GVFPVVATFIVSQKATDTILEELAADEGNER

Enzyme Prediction     

No EC number prediction in jhhlp_007070-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	32	624	1.5e-70	0.5145631067961165

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.20e-63	34	622	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.42e-55	33	620	1	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.18e-27	467	615	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.23e-17	129	367	19	203	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.88e-17	10	604	36	561	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP31667.1|AA3	1.51e-218	17	623	40	642
VBB86080.1|AA3	1.51e-218	17	623	40	642
QYT06228.1|AA3_2	4.61e-190	12	612	15	590
QRC93226.1|AA3	5.48e-182	7	622	1	665
CAE7177936.1|AA3	6.86e-182	12	623	16	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	1.77e-36	37	626	13	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	1.77e-36	37	626	13	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	4.39e-36	37	626	13	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6F97_A	3.27e-26	38	622	6	530	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	4.38e-26	38	622	6	530	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7FKL6|BETA_YERP3	7.01e-43	37	619	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	7.01e-43	37	619	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	9.57e-43	37	619	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	9.57e-43	37	619	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	9.57e-43	37	619	2	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000706	0.999253	CS pos: 25-26. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007070-t41_1-p1.