CAZyme Information: jhhlp_007047-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_007047-t41_1-p1
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		49397.65	6.5659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001034:389918-391395(+)

Full Sequence      

MLGQRILKGILALVASGVVPRANCEIKVTALKTTSLGTDPEGSARLNGMSFQQDALTTFN
GWQYVAYYESTGTYNRQNVALGRRNLNGGTDPSDWEILRFTDYNQQTQDSHNTISLGISS
DGKIHLSYDHHDVPLNYRVSNDGIATDPSAHTWSASLFGATRHDLPGGGPGPWNPVTYPR
FERANDDLLFEMRIGQSGSGDSYLYKYSSGAWSPIGRYIQGNNNNAYINGLDFANDTLTI
TWTWRETPDVVTNHDLGYAYSTDLGHTWKNNAGASIGSTVSPSSQGIHAFIIPQNSGILN
QEGQTVDFGGRVHVVNREKVGGVLTWLHYWRGENGQWTRNPIKHSLGALTQTGRRGKLAA
HPVTGDLFAILAANEGYDVAVYAATRASDYTDWKETWRSKSFDVEPLFDRALWRGQGGVE
AGKILSLFLNTQGGYPDRKVTVVDLEVQV

Enzyme Prediction     

EC	4.2.2.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	46	345	1.7e-94	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	1.32e-74	62	342	1	271	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KEZ46379.1|PL42	1.21e-300	1	449	1	450
UPL03481.1|PL42	1.28e-124	26	447	20	436
QRD05138.1|PL42	6.80e-124	26	444	21	431
CAE7186376.1|PL42	2.73e-123	26	448	21	435
CZS85905.1|PL42	1.23e-121	26	449	7	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESL_A	3.47e-121	26	449	3	421	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESK_A	2.78e-120	26	449	3	421	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	6.74e-119	26	449	5	423	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MUK_A	1.35e-31	46	336	35	293	Glycoside Hydrolase BT3686 [Bacteroides thetaiotaomicron VPI-5482],5MUL_A Glycoside Hydrolase BT3686 bound to Glucuronic Acid [Bacteroides thetaiotaomicron VPI-5482]
4IRT_A	3.74e-31	46	416	18	377	Crystal structure of a putative neuraminidase (BACOVA_03493) from Bacteroides ovatus ATCC 8483 at 1.74 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

jhhlp_007047-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.022449	0.977510	CS pos: 24-25. Pr: 0.7487

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_007047-t41_1-p1.