CAZyme Information: jhhlp_006872-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006872-t41_1-p1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		46270.31	5.0967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001033:522564-523811(-)

Full Sequence      

MKAKAYLVSLVTLLSTLTLGQKPSTPLSSSSRWILDANGSRVKLRCINWAGHMEANIPEG
LHKQPITYIADWVASAGFNCVRLTYSIDMALNPGLSVRDSFRAAAAETRIAEDAMLGLYD
SAVAMNPFLGGASVSDVFAKVIDELWQRGIMTILDNHVSKASWCCNLDDGNGWWSDAPIY
LAANSRYFDSAKWMDGLRAMARWSQNRPGIVGMSLRNELRATWTQILFASGTWYTKMTAA
ARAVHEINPDLLVVVGGLNGGTDLSPLRTRDMDTSSFRNKLVWETHDYPFTVTTPETGNC
DVTKANYGLFFGFVLEQGKSYTGPLWLSEFGVNMQGGPNAGLSDEDFTYLTCLVSYMENN
DADWALWAIQGSYYVRDGVLDNEETWGALDRDWKDWRNKDFKSLLGNMWTTTQRP

Enzyme Prediction     

No EC number prediction in jhhlp_006872-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	34	369	1.2e-114	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.05e-07	35	369	1	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC77964.1|GH5_11	5.16e-199	19	415	18	416
ATY62039.1|GH5_11	1.40e-197	14	415	107	507
QLI72535.1|GH5_11	2.76e-194	21	415	23	417
UNI21554.1|GH5_11	6.65e-194	9	415	15	422
AEO69593.1|GH5_11	1.41e-173	7	415	7	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	5.03e-22	29	392	8	342	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	1.27e-21	29	394	8	337	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
4TUF_A	6.50e-11	29	411	4	346	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	8.43e-81	10	415	14	401	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	2.44e-20	29	394	49	378	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	1.23e-14	34	408	46	381	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P19487|GUNA_XANCP	2.97e-10	9	411	8	371	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999743	CS pos: 20-21. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_006872-t41_1-p1.