CAZyme Information: jhhlp_006827-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006827-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	NLAX01001033|CGC1	57420.24	4.3880

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001033:331670-333354(-)

Full Sequence      

MRKSVIVGGLAPLLLPSASARASYIPIRECMGNASVPFDVPDSDDWALDVAPFNERLPYT
PIAIAVPRTVEHIEDAVKCAVGLGVKVAAKCGGHSYASLGLGGEDGHLVIEMDRMHDVTL
SEDGETAVIQGGARLGHVATELWEQGGRAISHGTCPGVGISGHALHGGFGMSSYTHGLAL
DWILSATVVLANGTTVRASADENADLFWALRGAGGSMGIVAEYEFATFEPVEEYTHFEAT
LNWTDPDSIVDGWLELQAWGEEEMPREMNMRFSVDMRGVMLDGLYHGSQSDMEDVVLPLL
ERVGGGVITSNVTFDWFGQLGQYAYTKDLNLTHPYNQHETFYAKSLFTHALPREAIASFI
SYTLTNASAILQDTSRAQPAKPSEPGEPSADPPRAQPPFLSSRFWWILVDIHGGANSYVS
QEVAHDSTSYAHRDKLLLFQFYDRSFGAYPPGEEPFKLLDGFVDSITAHLDEGDWGMYIN
YADPRVEDVAEEVYWGENVERLRGIKREFDPDDVFSNPLGIKPAV

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	51	521	4.4e-87	0.9890829694323144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	7.84e-27	61	199	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.63e-25	58	518	29	452	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	4.61e-12	478	522	2	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	6.50e-09	67	253	21	200	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
215242	PLN02441	2.29e-05	60	220	64	231	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO62186.1|AA7	2.19e-159	15	524	13	491
ANF89368.1|AA7	2.12e-155	17	524	17	495
AEO58513.1|AA7|1.1.3.-	2.12e-155	17	524	17	495
QKX64016.1|AA7	3.14e-152	27	524	10	473
AEO56694.1|AA7	3.48e-152	4	524	7	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	7.33e-157	17	524	17	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
1ZR6_A	2.74e-142	20	523	2	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	6.24e-141	20	523	2	478	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6Y0R_AAA	2.32e-135	20	523	15	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3RJ8_A	5.18e-132	27	524	3	472	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	3.77e-156	17	524	17	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.41e-140	10	523	7	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.19e-134	20	523	15	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	2.38e-132	13	524	11	494	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|E9F5F1|SUBF_METRA	5.51e-120	6	524	8	492	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008512	0.991446	CS pos: 22-23. Pr: 0.8615

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_006827-t41_1-p1.