CAZyme Information: jhhlp_006813-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006813-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		79313.76	4.2045

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001033:273343-276171(-)

Full Sequence      

MVRRPLSIPRFPLKEENKKVVTMRTTVLGIAAVVTTLLSVVSGRPHELRGAKILHRAEEV
DEEYDYVIVGAGTAGLTVADRLTADGKTTVLVIEYCHVISDEVTRAGGGRNFNDPGIRYN
ITSVEQPDMHNRTQQVRIGCCVGGSSAINGMVAVRGTRSEYDGWAELGGPDSTWNWEGVI
PYFRKAMHFTPPEEELAKTFNITWDPDAWGMEEDTHIYASFPTYQNPSIIPMYNAMAKMP
RIDIPLDGANGNNGLFWFPSSLDPNTYWRSYARTGHYDGIIDERDNLSVITRHKVRRILF
DDDLSATGVEFFPRDVDADAEEEGPITKTVKAKKEVILSAGTVHTPQILQLSGIGPKDLL
EEAGIDVLVDLPGVGQNFQDHAYLSVGYRWNNGAPPVPNVTIDGDPRTGSSPNLGAWIGL
PTMTEEFEEIASRYEAQDPADFLPANSHPWVVAGYADFQKLHAKLLRSKNTNILWYPLGG
SPGGIVMSMHVVSHGTINIDPTDPENEPIVDYRALSNPIDMDIMVENIRFLRKYMASEDF
AEYEPMETMPGIDVEGEDLKEWIRDVIIPTNFHPIATAAKKPKEKGGVVDEELLVHDVKK
LRVVDGSIMPLLPGANTQQPVYMLAEKAVDLIKARNGGDAKAEEPEAPEEEQAPVEEPEA
PSEEPEEPVEEAPEEEAPEEPEEPVEETPEEPEEEAPEEEPVEEEPIVEEPKEDE

Enzyme Prediction     

No EC number prediction in jhhlp_006813-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	63	634	1.5e-151	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.17e-89	61	635	3	534	choline dehydrogenase; Validated
225186	BetA	2.84e-84	59	637	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.08e-27	493	628	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.15e-21	131	381	16	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.95e-17	286	624	234	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80399.1|AA3_2	2.92e-161	48	633	23	628
CDP28753.1|AA3_2	6.88e-159	48	627	23	619
VBB78527.1|AA3_2	2.31e-157	53	635	25	616
AEO58401.1|AA3_2	9.50e-157	23	635	4	634
AEO63808.1|AA3_2	4.44e-154	45	633	23	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.77e-102	44	632	22	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.28e-96	60	633	2	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.34e-60	63	634	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.20e-59	63	634	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	6.91e-54	62	634	15	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.67e-97	49	637	23	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	6.15e-79	62	632	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.15e-79	62	632	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.48e-62	65	633	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.69e-61	61	634	33	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.388820	0.611175	CS pos: 43-44. Pr: 0.5686

TMHMM  Annotations     

Start	End
20	42