CAZyme Information: jhhlp_006809-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006809-t41_1-p1
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	NLAX01001033|CGC2	50771.29	8.3668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01001033:262146-263764(+)

Full Sequence      

MAVILVPRRRALRRIAVYVLAILLTYQVAKLILPADNFILLAIHFQAVCLYSLFHSTAAT
DSWIRSSTGPYSVDFESRVGLLIKTGWGTRQRLPAQLEALGLDQWDPDRTIVVADFEQDA
NTTTGAPVIQDAVGGLMKELAPRGLNKAHRFKKYQSLKNAIDDGDEQRAALIGANVGWEL
DALKFIWGLRTVYTTLPPKDWYLILDDDSFIVIESLKQLLSHLDPATPYYLGNTVGDYRG
RFAHGGSAVVLSRAAVDKLYRENPHVAAEAQINSLTEIWGDKLVATTLQKINIHIDERFN
HLFNGESPVDTRIASNRFCSPLVSFHELKKPEDMKALGLAFKEKGARPTVWSDVWDMFGG
PSARGFNDRPMRQDHDYVGKLEPGRTKTSENIATAEKCMRLCMRHKKRCLAWKWDVQSKE
CHTSPWMTVGKRQVGVVSGINGEWAAEMMESC

Enzyme Prediction     

No EC number prediction in jhhlp_006809-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.28e-05	197	259	83	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
214680	PAN_AP	0.002	373	422	2	54	divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.
394981	PAN_1	0.003	377	426	7	55	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.
238532	PAN_AP_HGF	0.008	387	426	19	59	Subfamily of PAN/APPLE-like domains; present in N-terminal (N) domains of plasminogen/hepatocyte growth factor proteins, and various proteins found in Bilateria, such as leech anti-platelet proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC86597.1|GT31	7.16e-122	7	452	4	448
QPH01099.1|GT31	3.13e-113	8	452	5	448
UPK97676.1|GT31	6.66e-113	9	452	6	453
QYS98030.1|GT31	8.03e-113	13	446	10	447
QLI73237.1|GT31	2.57e-110	33	452	13	430

PDB Hits     

jhhlp_006809-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

jhhlp_006809-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999993	0.000001

TMHMM  Annotations     

Start	End
12	29