CAZyme Information: jhhlp_006683-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006683-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		41840.07	5.3367

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:4899360-4900803(+)

Full Sequence      

MTSGYCGDHHSGRAAPIALFGCWVCHGAKGVNLGGWLHQEAVIDPKFWVQYGGDALDEWD
LCVKLGPRCGPVLEQRYATCIQTSDIDTLAAAGINLLRIPTGYNAWVKVPGSALHTGRQV
EYLRAITNYAIAKYGMHVIVDIHSLPGGLNGMGLGGREGGYDWFQNQTALEYSYKAVDAA
ISFIQSSNYPQAFTLAPINEPVDNRDMSKFGTPEALTDAGAAWVLVYFEEVLARVKKVNA
KIPVMLQGSFKGEEYWAPHFDAGANIVFDMHHYYFAGRPATSANIPEWICIDAFGSTGDG
KFPVFVGEWSIQAASNNTFASRATNLNTGIKAWEKYAQGSAYWTFRFSGNVSVDGEGVQG
DYWSYESFVYMGMINSDSGISCA

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	77	356	2.1e-143	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.27e-08	81	323	25	250	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.77e-08	29	363	19	337	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD11613.1|GH5_23|3.2.1.-	5.94e-202	13	382	18	388
CEI67597.1|GH5_23	3.17e-194	13	382	18	386
CCT65263.1|GH5_23	4.04e-191	14	382	20	390
QPC63335.1|GH5_23	5.53e-191	13	382	18	389
QPC72217.1|GH5_23	7.85e-191	13	382	18	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	3.46e-148	23	375	14	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	6.37e-143	16	375	10	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	3.10e-16	29	310	10	288	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	3.21e-16	29	310	16	294	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	4.17e-16	29	310	10	288	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	3.71e-33	29	310	43	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|D4AJL7|EXG1_ARTBC	3.41e-32	29	309	35	301	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1
sp|B0XN12|EXGA_ASPFC	1.16e-29	29	310	43	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	1.60e-29	29	310	43	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	2.20e-29	29	310	43	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000010

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_006683-t41_1-p1.