CAZyme Information: jhhlp_006665-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006665-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	NLAX01000701|CGC10	34913.98	9.6133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:4854947-4856011(+)

Full Sequence      

MRFSSIFNFALLGLAAAVPTPTVEQGATGVLGKRASSITESCSIGYASTNGGTTGGKGGS
TTTVSTLAQFTKAAESSGKLNIVVKGSISGSTKVRVASDKTIVGASGSKITGVGLYIKGQ
KNVIVRNLKIAKVKASNGDAIGIEASTNVWVDHCDLSSDMSNGKDYYDGLLDINKGSDYI
TVSNTYLHDHYKTSLVGHSDSQTSDKGKLHVTYANCYWKNTNSRNALVRFGTVHMYNNYF
SGIQASGINSRMGAQVRVESSVWENSKKAIISEDSSEVGYVTVSDVSYGGSENTAPKGDF
SSSKIPYSFSLYGKGNVKSRIPSEAGQLLSF

Enzyme Prediction     

EC	4.2.2.2:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	83	263	1.9e-83	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.15e-67	83	267	1	190	Amb_all domain.
226384	PelB	6.69e-59	64	326	59	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	6.50e-39	69	263	5	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96522.1|PL1_7	2.50e-135	1	329	1	327
CEI41234.1|PL1_7	1.16e-128	1	329	1	326
CCT64642.1|PL1_7	7.68e-127	1	329	1	326
QGI91872.1|PL1_7	7.68e-127	1	329	1	326
QGI78155.1|PL1_7	7.68e-127	1	329	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.95e-39	45	265	6	248	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	4.24e-31	39	242	4	248	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3ZSC_A	1.67e-29	52	252	20	225	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
2QXZ_A	3.69e-28	93	326	67	323	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]
2QY1_A	3.69e-28	93	326	67	323	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00645|PLYB_EMENI	1.07e-111	1	329	1	326	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1
sp|Q2TZY0|PLYB_ASPOR	1.31e-107	1	329	1	326	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|B8NBC2|PLYB_ASPFN	1.31e-107	1	329	1	326	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q0CBV0|PLYB_ASPTN	4.77e-105	1	329	1	325	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|O59939|PLYB_COLGL	5.81e-105	19	331	22	331	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999664	CS pos: 34-35. Pr: 0.3518

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_006665-t41_1-p1.