CAZyme Information: jhhlp_006540-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006540-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	NLAX01000701|CGC8	54347.76	6.3263

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:4262184-4263632(-)

Full Sequence      

MRFSDYFPVPWSKSRPSLSLPAHQGDEVVTKPTKGWRKMAILIAVAVALFFVLIYRLRAS
QWALSVPWIPDPASLAFTKENRLPPASDLAPPISSYSLPLSTQGRDIVDARGKRVKLASV
NWYGASDELFVSGGLDVKHRDEIARLIRKLGFNSVRLPYSDELVIENPVVRDEDVAANPD
LIGKTALDVFTATVKSLTKEGVAVIVNNHITRASWCDGFDLCDAAWSNDHLGPFCKVRQT
EEEWIQHWETIMEPLVSDPYVIGVDLRNEVRGLWGTMSWAKWAAAAEKCGDRLLAMNPDW
LVVVGGISSGNDLSGAATRPVRLSVARDRVVYSSHSYSWSGWGEPWKGMYAKRNYESFVS
TVRRHWGYLLENDIAPVWVGEFGAPGRPGVGDARYWRHLVRYLTALDADFGYWALNPRKV
GLSGSKEETYGLVREDWETPVLDYRMKDMIGLMKVQEPNRYRVEDGERREAEDDVDGKAW
EL

Enzyme Prediction     

No EC number prediction in jhhlp_006540-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	107	420	1.4e-152	0.9873015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	5.91e-23	108	417	1	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.84e-10	140	425	75	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC66231.1|GH5_24	3.49e-189	40	453	90	498
CCT62409.1|GH5_24	1.07e-188	55	453	99	490
QGI76084.1|GH5_24	1.07e-188	55	453	99	490
QGI58869.1|GH5_24	1.07e-188	55	453	99	490
CZS75738.1|GH5_24	1.41e-188	40	453	90	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	3.47e-41	102	439	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	1.29e-40	102	439	8	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
4TUF_A	1.17e-29	105	437	7	329	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]
3AXX_A	3.37e-24	115	439	61	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3VVG_A	3.55e-24	115	439	28	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	7.96e-47	75	451	18	379	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	5.60e-39	102	439	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	1.68e-32	95	458	26	397	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	1.56e-30	78	439	15	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P10474|GUNB_CALSA	2.77e-30	100	439	630	984	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000021

TMHMM  Annotations     

Start	End
40	57