CAZyme Information: jhhlp_006085-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006085-t41_1-p1
• CAZy Family: GH45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	NLAX01000701|CGC4	91185.41	5.2930

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:2345487-2348303(-)

Full Sequence      

MADINVEETLKKLTLTEKVDLLAGTDFWHTKSIPEKGIPALRFTDGPNGVRGTKFFNGIR
AACFPCGTSLGSTFNTKLLEEAGKKMGEEAKLKGAHVILGPTMNMQRSPLGGRGFESPSE
DPVLSGLASAALIKGIQSTGVQATAKHFVCNDHEHKRNAVQVIVTERALREIYALPFQLC
VRDSNPGAFMTGYNGVNGTYCSENPKIIDDLLRKEWGWDGTIMSDWYGTYSTTDAMHAGL
DIEMPGPSRFRGDALKFNVSTDKVREHILDERVRGVLKLIKACAATGVPENAPELTGDTP
ETAELLRKIGNEGIVLLKNENNVLPLKKDKKTVVIGPNAKVATFHGGGSAALAPYYTVTP
FAGISSKLETAPEYTIGAYSHKLLPLLDEVVKTADGKPGMNMKVYLEAPSVSSREVQEEY
VITKTELLFVDYYNPKIKAGIWYADFDGEFVAEEDAEWEFSLIVCGTARLYINGELVVDN
SINQTQGTHFFEQGTIEEKGRIHLKKGENYKVKVEFGSTPTSELSKVRALFDNGVLRVGG
CPIIDGKKEIEKAAALAKDADQVIICTGLNADWESEGFDRQAMDLPGHLDELIATVADAN
PNTVVVVQSGTPVTMPWISKVPGLVQAWYGGNETGNSIADIVFGDANPSGKLPLSFPKTV
QDNPAFLHFSTEAGRVLYGEDIYIGYRFYEYAKREVLFPFGHGLSYTSFEFSDLSVQEKD
GKVTAKVTVKNTGSRKGSEVVQVYVAPKQAAQVSRPIKELRGFSKVELEAGESKSVTVEI
ETKYAVSYFDETRNKWCAEKGEYEIIASNSSEIKEGQALKGTITVGETTWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	245	3e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.56e-68	25	341	47	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.59e-65	64	817	120	761	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.60e-54	314	686	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	8.97e-41	13	781	60	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.19e-38	37	279	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84651.1|GH3	0.0	1	834	1	833
QBZ56956.1|GH3	0.0	1	834	10	844
UKZ86562.1|GH3	0.0	1	834	1	836
UKZ50443.1|GH3	0.0	1	834	1	835
ABH82050.1|GH3	0.0	1	834	1	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.37e-275	1	834	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.01e-268	5	834	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.33e-134	4	825	3	674	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.52e-112	5	811	4	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.07e-107	6	827	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	0.0	1	834	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	834	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	1	834	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	1	834	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	0.0	1	834	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999865	0.000153

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_006085-t41_1-p1.