CAZyme Information: jhhlp_006073-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_006073-t41_1-p1
• CAZy Family: GH45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		30511.65	4.7048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:2308326-2309340(+)

Full Sequence      

MTRQILGLLLAAASASTVLGASGSGSSTRYWDCCKPSCSWSGKGSLLQGPVLSCDKNDNP
LSNPDVKSGCDNGSAYTCSNNSPWAVNDQVAFGFAATHISGGNEASWCCACYKLTFTSGP
VAGKTMVVQSTNTGGDLSGNQFDLQIPGGGVGIFDGCASQFGQSLPGERYGGISSRSQCD
SFPASLKDGCYWRFDWFNNADNPSHTFEQVQCPSELVAISGCRRADDSSFPVFQLPSSPA
TSSTTPPASSTSLPPSGGASQWAQCGGIGWSGPTTCVSPYQCTKLNDYYSQCL

Enzyme Prediction     

EC	3.2.1.4:59	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	25	222	3.8e-88	0.98989898989899
CBM1	261	289	6.6e-16	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.06e-84	24	223	1	214	Glycosyl hydrolase family 45.
395595	CBM_1	4.31e-12	261	289	1	29	Fungal cellulose binding domain.
197593	fCBD	4.80e-11	261	293	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA27871.1|CBM1|GH45|3.2.1.4	4.12e-137	10	292	11	292
CAD70529.1|CBM1|GH45|3.2.1.4	4.12e-137	10	292	11	292
AAY00849.1|CBM1|GH45	9.71e-135	5	293	6	299
CAH03187.1|CBM1|GH45	9.71e-135	5	293	6	299
AEO64667.1|CBM1|GH45|3.2.1.4	9.71e-135	5	293	6	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.42e-138	10	292	11	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	5.56e-117	21	233	1	211	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	6.39e-117	21	233	4	214	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1OA7_A	4.00e-110	25	238	3	214	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
1HD5_A	7.77e-110	25	236	3	213	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	2.95e-118	9	234	6	231	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	9.33e-108	25	236	3	213	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	1.07e-77	22	224	19	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	4.72e-59	20	222	35	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	4.41e-48	25	225	269	501	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999733	CS pos: 20-21. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_006073-t41_1-p1.