CAZyme Information: jhhlp_005969-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005969-t41_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		51682.89	9.5276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:1929723-1931238(+)

Full Sequence      

MSATIAFAFTFVAGIVAALILISFSKYLFKLLPSRYRPAQDPKHDRYQILVLGDIGRSPR
MQYHALSIVKSGAYVDLVGYKETARHPGLVGNPQVGLYPLTPQPEWLRWQMSLFIGLPLK
AVWQSYDLFCTLAYTAPAAKWIIIQNPPSIPTLHIAYIVSWLRGSKVMVDWHNYGYTIMA
VNRSPSNPLVKLYKRYECFFGRRTPDVSITVTEAMGRDMRKPPFRLKMPILTLHDRPAAT
FQPMTSRDERKKFLLGLRETTDYAENIIAGKTRLVVSSTSWTPDEDFGILLEGLIKYAEG
DSTDGSAKGQATPLLVIITGKGPQKADFEQMMKKLKAGGHLPNVDITTAWLSTRDYATLL
AAADLGVCLHRSSSGVDLPMKIVDMFGAGLPVAAYSAYESFNELVREGENGCGFETADDL
SVVLRRLLSGNAAELKGLRQGAVKEGSRRWDDEWGPVIGKTLGLVA

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	46	459	2.1e-138	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	42	460	1	409	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	7.82e-135	46	428	6	371	transferase, transferring glycosyl groups
340831	GT4_PimA-like	9.45e-12	149	464	90	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340816	Glycosyltransferase_GTB-type	2.35e-06	189	411	39	232	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
340825	GT4_WbuB-like	2.95e-05	142	414	102	342	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC76213.1|GT33	4.77e-204	12	465	11	466
UPK97115.1|GT33	2.57e-195	6	465	4	457
QKD52974.1|GT33	4.06e-194	6	465	4	457
QPC63869.1|GT33	7.69e-192	12	465	10	457
CZS74228.1|GT33	1.26e-190	12	465	10	457

PDB Hits     

jhhlp_005969-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZD1|ALG1_ARTBC	9.66e-112	22	465	12	446	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01551 PE=3 SV=1
sp|O13933|ALG1_SCHPO	9.19e-88	46	458	26	416	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q6C3K2|ALG1_YARLI	1.35e-84	37	464	31	440	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|Q921Q3|ALG1_MOUSE	2.50e-83	49	454	37	453	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q8L7M0|TUN_ARATH	1.72e-82	43	466	3	463	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

Start	End
7	29