CAZyme Information: jhhlp_005885-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005885-t41_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		42952.18	3.8737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:1536206-1537517(+)

Full Sequence      

MGYYNADSSRPVGRFPSVYFWASGSIWATLVDYQHYTGDESFNKDILAALSDSKNIGPNK
DYLYETSDVRTTDDIATWALAALAAAERNLPQPNPDVPSWLTLAENSFNYLSGLWDADTC
GGGINWALDTEEVQLQPYKSTLTIGAVFQLAARLARATGDENGDFASFANQVWDWSVKVG
FVDPGFNVYDGALADDDCSRINKVQFSHTAGLYLLGSAVMANVTGDEKWIGRAQNLTDRA
IEVFFGGEEQNVLTEVSCESVGSCTDDMAVMKGSFASALWRSTQMLPSLDQAARPVLESS
AQAAVAACTEGDSGEECPMSWVDKSSGGIGAGEQASVLALVQGLLISESDAPYSEGQVDG
GSSSNGSGDSNGSSGSGSGGSDESGAISMRASAAVVVGSFMLATLSLI

Enzyme Prediction     

No EC number prediction in jhhlp_005885-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	5	350	3.7e-67	0.8938547486033519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.41e-88	1	338	14	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64344.1|GH76	4.31e-97	1	352	42	399
QUC22573.1|GH76	8.78e-96	1	354	47	406
ANH56506.1|GH76	9.00e-89	19	345	17	344
QPG94756.1|GH76	2.52e-88	1	358	42	405
QGI77779.1|GH76	4.36e-88	1	352	43	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.11e-58	19	366	75	430	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.92e-63	1	368	44	405	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	4.01e-62	1	364	41	399	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	2.27e-59	12	364	54	401	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	2.87e-59	19	366	61	406	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	7.72e-59	1	363	44	403	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000021

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005885-t41_1-p1.