CAZyme Information: jhhlp_005752-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005752-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		67405.03	4.3319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:1041501-1043446(+)

Full Sequence      

MRSFLLASILAAVAFAADEPEYETYDYIVVGSGPGGGPLAANLARAGYSTLLVEAGDDHG
SLSVYSELSNFNAAGNDERSRWDFFVKHSDDPERELKYERMTWRTAEGEFYVGLEPPEGA
EQLGIFYPRAATLGGCAMHNAGVCSLPSADEWNWVANITGDATWEAENMRKYLIQTEKNL
YMPEGSEGHGFDGWMSISTSDASWVATGDWPANKIITKLAELTDQDPEKVAELADKDILT
PGEDHLSSFYNMAQHGDARGRRSSPNNYIKATLADEANYPLTLALNTLVTKVLFDEEAET
PTAIGVEALQGASLYRADPRYNAESNKTLTRFYAKREVIVSGGAFNSPQILKLSGIGPAA
ELEKFEIPVVVDLPGVGENLGDNYEGSVLALGQSPTGGSRITVLFRTPSAPTENRNIFAW
CGAFAFEGFWPGFPDDYGANQYSCAMVHMNPKSQAGSVRLTSADPQDIPDINFRFFEHEG
DQDLLELVEGANLLRESWQVAGDEVLPYDEMHPCPGTGAGDCTIAQQAETIKLQAYSHHA
TSTCAIGADDDKNAVLDSKFRVRGVKNLRVVDASSFPRVPGAFPVLPTAMLSAKATEEIL
ADAEKADAPAEEPTKKCKRGL

Enzyme Prediction     

No EC number prediction in jhhlp_005752-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	608	4.6e-75	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.16e-52	39	603	22	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.97e-50	259	600	196	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.60e-29	451	595	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.55e-18	257	584	215	561	Protein HOTHEAD
366272	GMC_oxred_N	2.34e-14	125	385	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81166.1|AA3	4.92e-268	1	610	1	621
CAP64871.1|AA3	6.98e-268	1	610	1	621
CDP29384.1|AA3	6.98e-268	1	610	1	621
QBZ53739.1|AA3	3.51e-247	1	606	59	665
QRD01027.1|AA3	1.42e-203	6	602	10	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.28e-29	25	604	14	540	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.28e-29	25	604	14	540	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	3.10e-29	25	604	14	540	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6F97_A	4.95e-29	25	603	6	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	6.64e-29	25	603	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ60|ATC_ASPTN	9.31e-34	24	600	45	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	8.42e-33	25	603	36	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|C3K3D3|BETA_PSEFS	3.52e-32	23	599	3	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	8.62e-32	23	599	3	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q88AE7|BETA_PSESM	2.12e-31	25	599	7	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000329	0.999633	CS pos: 16-17. Pr: 0.9815

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005752-t41_1-p1.