CAZyme Information: jhhlp_005749-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005749-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		40818.31	4.3034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:1022424-1023611(+)

Full Sequence      

MARPQRTFSNCIGLILITLSVISSSAPTRLDPRTSWTGLSSREFTEEGCRPIIFIYARET
IAPGNMGFWVGPEISNRLKLYFGVENVATEGVDYLGLKDTNLFPGGAPPFGIYLMQVLLT
RAVTECPTSKVIAAGYSQGAAVLHRAVQYLDEDIRDHITAVVTFGDTQTLQDGGRIIGYP
LDKTLIICNVGDIICTGTLYVFPIHLDYTKRVPEAVHWLIWKILSSYFNPPITPWYWWQH
PPPGWKLPPEEGDDEGEGNDDGEDDHSRWATMIPPYMSMFPSIPVGDPAPTVTVGIDPEP
TDPDIGDVLSAYPELSTILTSHIPDFETEIPEKPTPAPTRNSDLTTATVTVTATVTVFQP
PVLGCPSSGEPGG

Enzyme Prediction     

No EC number prediction in jhhlp_005749-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	49	220	2.6e-30	0.9735449735449735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.62e-42	49	223	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52366.1|CE5	2.94e-62	14	226	5	223
UQC73970.1|CE5	5.36e-60	11	223	16	224
QDS69670.1|CE5	2.48e-52	15	208	6	197
QRC93889.1|CE5	5.67e-52	13	226	5	218
QBZ62508.1|CE5	4.99e-51	19	226	11	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X88_A	8.35e-39	38	219	12	194	Chain A, cutinase [Malbranchea cinnamomea]
3GBS_A	1.65e-37	43	220	15	193	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	6.72e-37	43	220	6	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
1AGY_A	7.31e-36	49	208	17	177	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]
1FFE_A	1.50e-35	49	208	31	191	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MZV6|CUTI2_MAGO7	2.77e-49	12	223	5	214	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|Q4X1N0|CUTI1_ASPFU	3.02e-43	16	223	5	211	Probable cutinase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G09380 PE=3 SV=1
sp|B0XRY3|CUTI1_ASPFC	3.02e-43	16	223	5	211	Probable cutinase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_025250 PE=3 SV=1
sp|Q5B2C1|CUTI1_EMENI	4.50e-43	12	223	5	213	Cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut1 PE=2 SV=1
sp|A1DGN0|CUTI1_NEOFI	5.96e-43	16	223	5	211	Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_084890 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001907	0.998072	CS pos: 24-25. Pr: 0.9657

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005749-t41_1-p1.