CAZyme Information: jhhlp_005523-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005523-t41_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		35607.98	9.6570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000701:149213-150312(+)

Full Sequence      

MHFAYPPRKASNPPAFKPRSSRIPVLRKGKLRTIALFGVAVLFLLYLFSGSSKSGPKKTR
HVPSGTPPVVMVTVLDSSHGLEYMDTIKENRISYAKLHGYETFFAHVGDYDLLGSPMSWT
KVVALRHVLNKFPDCQYIWFLGQDAFIMDPKVSIHKDIMAADKLGQLMIRNQPVALPDSI
IKTYQHLRPENVDLVVTQDSEGMSPESIIIKNSEWAEFFLDTWYDPLYRSYNFQKAETHA
LEHIVQWHPTVLSKLALIPQKTLNSYSREQYGVKYSNGDFVVRFAECTKTGATSCQQEAG
RFNELRRNAFAKG

Enzyme Prediction     

No EC number prediction in jhhlp_005523-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	67	291	4.7e-72	0.9715447154471545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	5.44e-76	65	287	1	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	9.05e-05	60	156	117	222	glycosyltransferase; Provisional
215617	PLN03182	2.33e-04	64	223	124	265	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB77835.1|GT34	8.17e-128	1	312	1	312
QPG93680.1|GT34	2.33e-127	1	310	1	310
UKZ96164.1|GT34	5.25e-126	1	310	1	310
ATY64005.1|GT34	7.19e-126	1	310	1	310
ANH56523.1|GT34	4.43e-125	1	312	1	312

PDB Hits     

jhhlp_005523-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	1.99e-42	51	307	48	311	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	3.86e-34	83	287	123	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.06e-31	83	287	123	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	1.87e-29	89	287	113	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|P46985|MNN11_YEAST	3.52e-27	67	300	158	413	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999966	0.000032

TMHMM  Annotations     

Start	End
31	50