CAZyme Information: jhhlp_005337-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005337-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48746.10	5.2786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000697:797727-799100(+)

Full Sequence      

MRQFNSRIVRRVAGAAALSLFFFLAIHELAAETPFVTPSFHRISEPIKHTIDHITQGTKP
ENSGSLFPGATLAGGNPELLKNATAYIDSIMNPANPTFERLACPNSDYRRYHNLRPTGSP
QPTYLFAINLRESIAVLPTLLGSIIETIRFLGPKYCALSIVEGHSKDGTFEVLNLLRAEI
ESLGARYYFQRSDIDPSTSGDRIGGLAALRNLALKPLTDSPNDFAPQSTIIFLNDVSLCP
EDILELVYQKQILDADMTCGFDWTYVGQDPTFYDVWIARTLAGDSFFEIPPDGNWNSAWN
LFWNAPDDRARFGAHKPFQVFSCWNGAAVFSATPLIDHNIRFRAPTAAECFQGEPQLFCK
DLWRAGYHKIAVVPSVNLEYDDEHAAKIKALKGYVSQWAEAEAGEPASITWQAKPPDEVK
CMASYATQEWRPWNEGS

Enzyme Prediction     

No EC number prediction in jhhlp_005337-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	124	363	9e-72	0.9874476987447699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	1.15e-94	123	358	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84687.1|GT69	1.30e-163	70	435	104	471
AEO64631.1|GT69	2.34e-151	85	435	74	437
QYS99732.1|GT69	1.85e-145	15	435	9	417
QLI67260.1|GT69	3.73e-145	16	435	11	417
AEO59312.1|GT69	5.85e-145	91	435	1	358

PDB Hits     

jhhlp_005337-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	6.34e-49	66	435	66	446	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000664	0.999287	CS pos: 31-32. Pr: 0.6422

TMHMM  Annotations     

Start	End
12	31