CAZyme Information: jhhlp_005277-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005277-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	NLAX01000697|CGC2	39405.00	7.2898

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000697:542707-544269(+)

Full Sequence      

MGLFKTVVSAIAGLSALAGVNAASLQQVASFGDNPSGARMYIYVPDKVASSPAIVVAIHY
CTGTASAYYNGTPYARLADQHGFIVIYPESPYDGGCWDVSSNASLTRGGGGNSNAIANMV
TYTLSKYNGDKSRVFATGTSSGAMMTNVLAATYPDMFAAASVYAGVPAGCFYTGTVNGWN
NTCSSGQSIHTQAEWASTAFAMYPGYGASAPRPKMQIYHGDADTILYPQNWQETIKQWTG
VFGYSTTATNTETGLFGGAWTRYTYGPKVQGIFGAGITHNLPIQGDEDMKWFGITGGSSS
SSTTLVTSTKTASSSTSTTKAPATTTTAATGGQARWGQCAGIGWSGPTAVMEIRSPVYGD
MVDVVVLVDRPGAVVKFT

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	39	197	3.7e-21	0.6431718061674009

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.09e-25	8	168	18	180	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.24e-22	42	237	5	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	1.12e-06	124	165	261	302	Predicted peptidase [General function prediction only].
224423	DAP2	4.70e-05	38	166	380	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223730	Aes	0.004	22	152	48	172	Acetyl esterase/lipase [Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87946.1|CE1	2.68e-138	9	295	9	293
CDP22812.1|CBM1|CE1	1.10e-131	13	360	9	363
VBB71849.1|CBM1|CE1	1.10e-131	13	360	9	363
CAP60171.1|CBM1|CE1	1.10e-131	13	360	9	363
QMW35424.1|CE1	2.57e-127	22	295	32	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	2.60e-120	24	293	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBW4|AXE1_ASPFU	2.49e-128	4	349	13	353	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	4.56e-128	22	295	32	306	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	2.62e-127	22	295	32	306	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	2.62e-127	22	295	32	306	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	1.70e-125	4	348	13	349	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999753	CS pos: 22-23. Pr: 0.9714

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005277-t41_1-p1.