CAZyme Information: jhhlp_005265-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005265-t41_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	NLAX01000697|CGC5	98605.15	4.8496

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000697:505249-507895(-)

Full Sequence      

NPQIRLVSAMPRRSVIPLDQGWQFKQVDKESSEYLPVAQFPTNVHLDLLHHKLIPDPFIG
KNELEVQWIGEAVWSYRTTFASPADVPEGAKTVIVFDGLDTFATVKLNGDVILETDNMFI
PERVDVTGKLKADGENELEITFDSAYLRGCQLVDKYPEHKWGCWNGDVSRLAVRKAQYHW
GWDWGPTLLTCGPWRPINLEVYDSRLEDLFFETDVDPETRTAKVTTIARTEGSASKVRFD
ISLDGTSVASQTVDATAGTDIKAEFTVTDAKLWFPVRYGEQTLYTITATLLADSDEVDTI
TKKTGFRKAELVQQPLEEQPGTSFFFRVNGIPVFCGGSDWIPADNFIPRITRENYRNWIR
LLADGNQFMIRVWGGGIYEEAAFYEACDEFGILVWQDFMFGCGNYPAWPELLKSIEREAV
ANVKALRHHPSIVIWAGNNEDYQYQESENLTYDFENKDAESWLKTDFPARYIYEKVLDDV
CKEHIPGTFYHYGSPWGGKDTRDPTVGDIHQWNVWHGTQEKYQNFDTLVGRFVSEFGMQA
FPSVKTIDQYLPLGRDDPDRYPQSSTVDFHNKADGHERRIALYLVENMRYAPDPLEHFVY
CTQLMQAECLASAYRLWKRQWKGPNREYCGGALVWQINDCWPVTSWSICDYYLRPKHAYY
TVKREMAPLSIGITRREHHHPRDKHTRVHIETKTQIEIWGSNLALEDITVDCVVKAWNVE
TGEETYNEIMHKDLVLPPNRSTEIAALEVPVKNKGDEARTVVAAYLYRGEEKLARYVNWP
EPLKYLHLQKPKELVAKLVDGGAKVEISAEVPVKGVALECEDDAVVFEDNLVDIVPGEVV
TIATRGASESTNVTTRYLSMLN

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	9	759	4.7e-100	0.7154255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	9.48e-85	10	663	7	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	7.88e-14	694	785	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	3.59e-13	205	307	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	4.33e-06	799	842	11	54	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
236657	PRK10150	0.002	13	334	10	293	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87618.1|GH2	0.0	5	862	21	877
AEO69937.1|GH2	0.0	10	861	1	851
AFJ59925.1|GH2|3.2.1.25	0.0	10	861	1	855
VBB71464.1|GH2	0.0	15	861	8	854
AEO53082.1|GH2	0.0	10	861	1	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.70e-143	8	673	19	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.92e-123	15	838	8	810	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.07e-123	15	838	10	812	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.14e-123	15	838	10	812	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	8.21e-123	15	838	8	810	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	10	861	1	855	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q0CCA0|MANBB_ASPTN	1.73e-304	18	846	9	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1CGA8|MANBB_ASPCL	5.28e-304	17	846	8	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	1.39e-301	10	846	1	830	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	5.62e-301	10	846	1	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005265-t41_1-p1.